KEGG   Pseudomonas aeruginosa PA38182: BN889_00192Help
Entry
BN889_00192       CDS       T03031                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paeu  Pseudomonas aeruginosa PA38182
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN889_00192 (ahpF)
Enzymes [BR:paeu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BN889_00192 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like K_oxygenase FMO-like AlaDh_PNT_C DAO NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CDI88272
LinkDB All DBs
Position
183688..184500
Genome map
AA seq 270 aa AA seqDB search
MAIENFISVQETEGPKLARALEEHVRHYEVDIMNLQRASKLVPAKNAGELHEVRFESGGS
LKAKTLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVIGGGNSGVEAAI
DLAGIVAHVTLLEFDSKLRADAVLQRKLYSLPNVEVITSALTSEVKGDGQKVTGLVYKDR
NSEEFKSIELEGIFVQIGLLPNTEWLKGSVELSPRGEIIVDARGETSLPGIFAAGDVTTV
PYKQIVIAVGEGAKASLSAFDHLIRTSAPE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgagaacttcatctcggtgcaggagaccgaagggccgaagctggcacgggcg
ctggaagagcacgtgcgtcactacgaggtcgacatcatgaacctgcagcgcgccagcaag
ctggttccggcgaagaacgccggcgagttgcacgaggtgcggttcgagagcggcggcagc
ctcaaggccaagaccctgatcctcgccaccggcgctcgctggcgcgaaatgggcgtgccc
ggcgagcaggaatacaaggccaagggcgtgtgcttctgcccgcactgcgatggcccgctg
ttcaagggcaagcgcgtggcggtgatcggcggcggcaactctggcgtcgaggcggccatc
gacctggccggcatcgtcgcccacgtgacgctgctggaattcgacagcaagttgcgcgcc
gacgccgtgctgcaacgcaagctctacagcctgccgaacgtcgaggtgatcaccagtgcc
ctgaccagcgaagtgaagggcgacggccagaaggtcaccggcctggtgtacaaggaccgc
aactccgaggagttcaagtcgatcgagctggaaggtatcttcgtgcagatcggcctgctg
cccaacaccgagtggctcaagggcagcgtcgagctgtcgccgcgcggcgagatcatcgtc
gacgcccgtggcgagacctcgctgcccggcatcttcgccgccggcgacgtgaccacggtg
ccgtacaagcagatcgtgatcgccgtgggcgagggcgccaaggcttcgctgagcgccttc
gaccacctgatccggacctccgcgccggagtga

DBGET integrated database retrieval system