KEGG   Pseudomonas aeruginosa PA38182: BN889_01790Help
Entry
BN889_01790       CDS       T03031                                 

Gene name
stk1
Definition
(GenBank) serine-threonine kinase Stk1
  KO
K11916  serine/threonine-protein kinase Stk1 [EC:2.7.11.-]
Organism
paeu  Pseudomonas aeruginosa PA38182
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paeu02044]
    BN889_01790 (stk1)
Enzymes [BR:paeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     BN889_01790 (stk1)
Secretion system [BR:paeu02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BN889_01790 (stk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 APH_6_hur Kdo
Motif
Other DBs
NCBI-ProteinID: CDI89855
LinkDB All DBs
Position
1887198..1888187
Genome map
AA seq 329 aa AA seqDB search
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAG
GMGTVYRARDLLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRL
FTFDVDTACQRAYIVMELMPGLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVL
HGDLKPSNVMLGEEGVRLFDFGLGQAQAGILDGLPQLSRGRIDAWTPGYAAPELLEGAPL
SPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQLRAPGHLPRRCWPALRTALSL
DPERRCIGVRELQEALGARRSWLAGVLAR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaccgctgtcgtcgctggagctgctgccggaggaggagggcggcgcgaacctg
acctatttcgccttcgccgccccgaccgcctcggcgccggacctgccggcggtgttgccc
ggtccgctgccggacgttctttccgggcgctaccgtctggagcggatgctcggcgccggc
ggcatggggacggtctaccgtgcccgggacctgctccatgagcagttcggcgacccggcg
ccgctggtagcgctgaagctgctcaacgagtcggtcgccgagtcacccgacgccagcgcc
ttgctctatagcgagttcgccctgacccggcgcttgcgccatccgaacgtcgtgcgtctg
ttcaccttcgacgtcgacaccgcatgccagcgcgcctacatcgtcatggaactcatgcct
ggcctgccgctcgaccgcctgctctgcgagcgtcccgaaggcctgccctggtccgagctg
agcgcgatcgcccggccgttgctggatgttctggcctacgtccacgaacaaggagtactg
catggcgacctgaagccgagcaacgtgatgctcggcgaagagggcgtgcggctcttcgac
ttcggcctcggccaggcgcaggcaggcatcctggatggcctgccgcagctcagccggggc
cgcatcgacgcctggactccgggctacgccgctcccgaactgctcgagggcgcgccattg
tcgccggcggccgacctgtatgcgctggcctgcgtcctctacgaactggccgacggtcgc
catccgttccgccgcctgccctcgaaccaggcccgggagcaggggctggagcgccagctg
cgcgcgcccggacacctgcctcggcgctgctggccggcgctgcgtaccgccctgagcctc
gaccccgaacggcgctgcatcggcgtccgcgaattgcaggaagcgctgggcgcgcggcgt
tcctggctggccggcgttcttgcccgttga

DBGET integrated database retrieval system