KEGG   Pseudomonas aeruginosa PA38182: BN889_01943Help
Entry
BN889_01943       CDS       T03031                                 

Gene name
fabI_2
Definition
(GenBank) NADH-dependent enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00061  Fatty acid biosynthesis
paeu00780  Biotin metabolism
paeu01100  Metabolic pathways
paeu01130  Biosynthesis of antibiotics
paeu01212  Fatty acid metabolism
Module
paeu_M00083  Fatty acid biosynthesis, elongation
paeu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN889_01943 (fabI_2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN889_01943 (fabI_2)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BN889_01943 (fabI_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paeu01004]
    BN889_01943 (fabI_2)
Enzymes [BR:paeu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BN889_01943 (fabI_2)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BN889_01943 (fabI_2)
Lipid biosynthesis proteins [BR:paeu01004]
 Fatty acid synthase
  Component type
   BN889_01943 (fabI_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: CDI90002
LinkDB All DBs
Position
complement(2025974..2026381)
Genome map
AA seq 135 aa AA seqDB search
MGFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPE
LCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREASASPTT
SAPTASSPWPRPDGK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcacaggaaaacgcgccctgatcgtcggagtcgccagcaagctctccatc
gcttccggcatcgccgccgccatgcaccgggaaggcgccgaactggccttcacctaccag
aacgacaagctcaggggccgggtggaggaattcgccagtggctggggctcgcggccggag
ctgtgcttcccctgtgacgtggccgacgacagccagatcgaagcggtgttcgccgccctg
ggcaagcactgggacggcctggacatcatcgtccactccgtcggattcgctccaggcgat
cagctcgacggcgacttcaccgcggtgaccacccgcgaggcttccgcatcgcccacgaca
tcagcgcctacagcttcatcgccctggccaaggccggacgggaaatga

DBGET integrated database retrieval system