KEGG   Pseudomonas aeruginosa PA38182: BN889_04543Help
Entry
BN889_04543       CDS       T03031                                 

Definition
(GenBank) transcriptional regulator
Organism
paeu  Pseudomonas aeruginosa PA38182
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Sigma70_r4_2 HTH_23 Sigma70_r4 Terminase_5 HTH_29
Motif
Other DBs
NCBI-ProteinID: CDI92574
LinkDB All DBs
Position
complement(4742845..4743624)
Genome map
AA seq 259 aa AA seqDB search
MISFWNAPPGSPSADLRPFVELACALGGEGFPAALLETLGHWVAARHFNVLRIGAPRPEL
LLAGTRHRDAQLVWRCWQAYSRYYHSHDPLFLRMQRQRRGPVPLLGHLLAEDIEFDAYRE
AIYRDNGLSERLSSLHWDEEGRPLLFNLYRHREDGYFSEREIAAFEQWVPALLQLLRGHL
ALRRGRSATDEWRLALLHRATDLTPQELAVCLHLLRGLSHAGIAAELGLKESTVKTYRNR
AFARLDIHFRSQLFALVQG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcttctggaatgccccgccggggtcgccgtcggcggacctgcgccccttcgtc
gagctggcctgcgccttgggtggcgaaggcttccccgccgctctgctggaaacccttggc
cattgggttgccgcccgtcatttcaacgtgctgcgcatcggtgcaccgcgccccgaactg
ctcctggccggcactcgccatcgcgacgcgcaactagtgtggcgctgctggcaggcctat
tcgcggtactaccacagccatgacccgctgttcctgcgcatgcagcgccagcgccgcggc
ccggtgccgctgctgggccacctgctggccgaggacatcgagttcgatgcttaccgcgag
gcgatctatcgggacaatggcctgagcgagcggctgtcgagcctgcattgggacgaggaa
ggccggccgctgctgttcaatctctaccggcaccgcgaggacggctatttcagcgagcgc
gagatcgccgccttcgagcagtgggtgccggccctgctgcaactgctgagggggcacctg
gccttgcgccggggacgcagcgcgaccgacgagtggcggctggcgctgttgcaccgggcg
acggacctgacaccacaggagctggcggtctgcctgcacctgctgcgcgggttgagccat
gccggtatcgccgccgagctggggctcaaggaaagcacggtgaaaacctaccgcaaccgc
gcctttgcccgcctggacatccattttcgcagccagcttttcgccctggtgcagggctga

DBGET integrated database retrieval system