KEGG   Pseudomonas aeruginosa PA38182: BN889_04545Help
Entry
BN889_04545       CDS       T03031                                 

Definition
(GenBank) putative ferredoxin oxidoreductase subunit
Organism
paeu  Pseudomonas aeruginosa PA38182
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske
Motif
Other DBs
NCBI-ProteinID: CDI92576
LinkDB All DBs
Position
4744804..4745916
Genome map
AA seq 370 aa AA seqDB search
MSLPNANLIASSRKAAAQMATRDTSFIFNEWYVAAFAEEVGRELLARTLLGKRVVLYRTL
AGQAVALEDRCAHRSFPLSRSRLEGDGIVCGYHGFRYDSQGELIETPSQKACPRGVGIRH
YPLLERGPLVWIWLGDPRLADPKRLPQRPWLEDPGWACSKGYFLHPGNYVSMHENLMDLT
HLTYLHANTIGTPDYAGAPYELDLKEGHYRLVRHVLPTTLSPVWGRTTGLDGCPTAARIT
TSEFLSPGLHQVSATFYDTALPAERRPEFHIRTAHILTPETHGSMHYFIVHGRDFAQDDE
TVGAFMHEQLFAAFVEDVEGLGALEKVLAEADEDSYEISVASDAPAVATRTYLKRRADEE
ARQRAAHRVA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccaacgccaatctcatcgccagttcacgcaaggccgccgcgcagatggcc
acgcgcgacacgtcgttcatcttcaacgagtggtacgtcgccgccttcgccgaggaggtc
ggccgcgaactgctcgcgcgcactctgctcggcaagcgcgtggtgctctatcgcaccctc
gccggccaggcggtagccctggaagaccgctgcgcgcatcgctccttcccgctatcgcgc
agtcgcctggagggggacgggatcgtctgcggctatcacggtttccgctacgacagccag
ggcgagttgatcgagacaccgtcgcagaaagcctgtccgcgcggcgtcggcatccgtcac
tacccgcttctggagcgcggcccgctggtctggatttggctcggcgacccgcgactggcc
gacccgaagcgactgccgcagcggccctggctggaggatccgggctgggcctgctccaag
ggctacttcctacacccgggcaactacgtgagcatgcacgagaacctgatggacctgacc
catctcacctacctccacgccaataccatcggcaccccggattacgccggggcgccctat
gagctggacctgaaggaaggccactaccggctggtacggcacgtgctgccgaccaccctg
tcgccggtctggggccgcaccaccggcctcgacggctgtcccacggcggcgcgcatcacc
acctcggagtttctctcgccaggcctgcaccaggtcagcgcgaccttctacgacacagcc
ctgcccgccgagcggcgaccggaattccacatccgcacggcgcacatcctcaccccggag
acccacggcagcatgcactacttcatcgtccacggacgcgatttcgcccaggacgacgag
accgtcggcgctttcatgcacgagcaactgttcgccgccttcgtcgaggacgtggaaggc
ctcggagcgctggaaaaggtactcgcggaggccgatgaggatagctacgagatctccgtt
gccagcgacgcgccggcggtggccacccgcacctacctcaagcgccgcgccgatgaggaa
gcgcgccagcgcgcggcgcaccgggtggcctga

DBGET integrated database retrieval system