KEGG   Pseudomonas aeruginosa PA38182: BN889_04560Help
Entry
BN889_04560       CDS       T03031                                 

Definition
(GenBank) putative HDIG domain-containing protein
Organism
paeu  Pseudomonas aeruginosa PA38182
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3391 HD HD_5 HDOD
Motif
Other DBs
NCBI-ProteinID: CDI92591
LinkDB All DBs
Position
4758167..4759411
Genome map
AA seq 414 aa AA seqDB search
MLKRIPVTQLRLGMFVQSLCGSWLDHPFWKRGGFLLDSQADLQRLRESAVKEVWIDASKG
LDLPEEAAVSAAAVLPVTMPAGPSPARVALEEEIRHAALLCSRAKAAVVSMFRDARMGQA
IDTAHASDLVDEISASVLRHPNALVSLVRLKTSDEYTYMHSVAVCALMIALARQLELPDP
LVREAGLAGLLHDIGKMAVPDPILNKPGKLTDQEFGLVRRHPQNGARMLLDCRQVSALVV
DVCLHHHERIDGTGYPFGLAQEQISLLARMGAVCDVYDAITSDRPYKKGWNAAEAIRRMA
EWNGHFDPQVFRAFVKAVGIYPVGALVRLESGRLGVVLEQHGRSLLTPRVKVFFSARSKV
PIPQQVVDLGRAGQTDRIVGFEPAETWNFRNLDEMWTGLAKSTGSYFDAGTGNP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaaacgcattccggtaacccagcttcgcctcggtatgttcgtccagagcctttgc
ggctcgtggctggaccacccgttctggaaaagaggtggcttcctgctcgacagccaggcc
gacctgcagcgcctgcgcgaaagcgccgtgaaggaagtctggatcgatgccagcaagggc
ctcgacctcccggaggaagcggcggtctcggccgctgcggtcctgccggtcaccatgccg
gccggcccttcgccggcgcgggtcgccctggaggaggaaatccgccacgccgccctgctc
tgcagccgtgccaaggccgccgtggtcagcatgttccgcgacgcgcgcatgggccaggcc
atcgataccgcgcatgcatcggacctggtggacgaaatctccgcctcggtgctgcgccat
cccaacgcgctggtcagcctggtacggctgaagacctcggatgaatacacctacatgcat
tcggtggcggtctgtgcgctgatgatcgccctcgcccgccagctcgaactgcccgacccg
ctggtacgcgaggcggggctggccggactgctgcacgacatcggcaagatggcggtgccc
gatccgatcctgaacaagcccggcaagctcaccgaccaggagttcggcctggttcgccgg
catccgcagaacggcgcgcggatgctgctcgattgccgccaggtcagcgccctggtggtg
gatgtctgcctgcaccaccacgagcgcatcgacggcaccggctaccccttcggcctggcg
caggagcagatcagcctgctggcgcgaatgggcgcggtgtgcgacgtctacgacgcgatc
acctccgaccgtccctacaagaagggctggaacgccgccgaggcgatccgacgcatggcc
gaatggaacgggcacttcgacccgcaggtgttccgcgccttcgtcaaggcggtgggcatc
tacccggtcggcgcgctggtcaggctggaaagcgggcgcctcggcgtggtcctcgaacaa
cacggccgctcgctgctgacgccacgggtcaaggtattcttctcggcccgctcgaaggtg
ccgatcccgcagcaggtggtagacctgggtagggccggacagaccgaccgaatcgtcggc
ttcgagccggcggaaacctggaacttccgcaatctcgacgagatgtggacgggactggcc
aagtccacgggctcttatttcgacgcgggaaccggaaatccgtag

DBGET integrated database retrieval system