KEGG   Pseudomonas aeruginosa PA38182: BN889_04857Help
Entry
BN889_04857       CDS       T03031                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
paeu  Pseudomonas aeruginosa PA38182
Brite
Enzymes [BR:paeu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN889_04857 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDI92884
LinkDB All DBs
Position
5070127..5070708
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHISAETLEYHHDKHHNTYVVNLNNLIPGTEFEGKSLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGNPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgaaaagaacgcccttgagccgcacatttcc
gcagaaaccctggaataccaccacgacaagcaccacaacacctacgtggtgaacctgaac
aacctgatcccgggtaccgagttcgaaggcaagagcctcgaagagatcgtcaagagctcc
tccggcggcatcttcaacaacgccgcccaggtgtggaaccacaccttctactggaactgc
ctgagcccgaacggcggtggtcagcccaccggcgccctggccgacgccatcaacgccgcc
ttcggctccttcgacaagttcaaggaagagttcaccaagacttccgtcggcaccttcggt
tccggctggggctggctggtgaagaaggccgacggctccctggccctggccagcaccatc
ggtgccggcaacccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggacttcgtagcgaagaatttcgctgcctga

DBGET integrated database retrieval system