KEGG   Pseudomonas aeruginosa PA38182: BN889_05983Help
Entry
BN889_05983       CDS       T03031                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00220  Arginine biosynthesis
paeu01100  Metabolic pathways
paeu01110  Biosynthesis of secondary metabolites
paeu01130  Biosynthesis of antibiotics
paeu01210  2-Oxocarboxylic acid metabolism
paeu01230  Biosynthesis of amino acids
Module
paeu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BN889_05983
Enzymes [BR:paeu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BN889_05983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CDI93996
LinkDB All DBs
Position
complement(6257286..6258440)
Genome map
AA seq 384 aa AA seqDB search
MPGSRDILADLVAFDTVSRESNLALIDYVRDYLAGFGVDSELFFDADGRKANLYATIGPS
DRGGVCLSGHTDVVPADGQAWSVPPFRLSERDGRLYGRGTADMKGYLACVLAAVPAFLAA
PLRLPVHLAFSYDEEVGCLGVRSLLAALERRPHKPLLCIIGEPTELKPVLGHKGKLAMRC
EVHGAACHSAYAPQGVNAIEYAARLIGRLGEIGARLAAPERHDRRFDPPYSTVQTGLIQG
GRALNIVPAECRFDFEVRALPADDPRQVAEELRDYAESELLPRMRAVERSTDIRFTPLSA
YPGLLTADDSQAAELIGLLSGSTDFSTVAFGTEGGLFHQAGIPAVICGPGSMDQGHKPDE
FVSLAQLEACDALLARLAAWLREP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcagccgtgacatcctcgccgacctggtggccttcgacaccgtcagccgcgag
tccaacctggcgctgatcgactacgtccgcgactacctggcgggtttcggcgtcgacagc
gaactgttcttcgacgccgacggccgcaaggccaatctctatgccaccatcggccccagc
gaccgtggcggcgtctgcctttccgggcataccgacgtggtgccggcggacggccaggcc
tggagcgtgccgccgttccggctcagcgagcgcgatggccgcctctacgggcgtggcacg
gcggacatgaagggctacctggcctgcgtgctggcggccgtcccggcgttcctcgccgcg
ccgttgcgcctgccggtgcacctggcgttctcctacgacgaggaagtcggctgcctgggc
gtccgttcgctgctcgcggcgctggagcggcgtccgcacaagccgttgctgtgcatcatc
ggcgagcccaccgagctgaagccggtgctcggccacaagggcaagctggccatgcgctgc
gaggtgcacggcgcggcctgccattcggcctacgcgccgcagggggtgaatgccatcgaa
tacgccgcgcggctgatcggtcgcctcggcgagatcggcgcgcgcctggcggcgccggag
cgccacgaccggcgtttcgacccgccctactcgacggtgcagaccggactgatccagggc
ggccgggcgctgaacatcgtgcccgccgagtgccgcttcgacttcgaggtccgcgcgctg
ccggcggacgacccgcggcaggtcgccgaggaactccgcgactatgccgaaagcgaactg
ctgccgcggatgcgcgcggtggagcgaagtaccgatatccgcttcacgccgctatcggcc
tatcccggcctgctcaccgcagacgacagccaggcggcggagctgatcggcctgctcagc
ggttcgacggatttctccaccgtggccttcggcaccgagggcgggctgttccaccaggcc
ggtatcccggcggtgatctgcggtcccggcagcatggaccagggccacaagccggacgag
ttcgtcagcctcgctcagctcgaggcgtgcgatgccctgctggcgcgcctggcggcgtgg
ctgcgggagccttga

DBGET integrated database retrieval system