KEGG   Pseudomonas aeruginosa PA38182: BN889_06698Help
Entry
BN889_06698       CDS       T03031                                 

Definition
(GenBank) putative major facilitator superfamily transporter
Organism
paeu  Pseudomonas aeruginosa PA38182
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Nuc_H_symport YfdX LacY_symp TPR_19
Motif
Other DBs
NCBI-ProteinID: CDI94704
LinkDB All DBs
Position
complement(6961127..6962656)
Genome map
AA seq 509 aa AA seqDB search
MPLIDQGKIEEAKAALQAALSTLVETRSVHPLPALRARLLLKRAETLVEDGQRSEASNER
LETLLNEARQQLAWRTRASPPAGPPGLETDMAHNNNSASYENVLLCVLFLTFGFVFFDRL
ALSFLFPFMEQELQLSNSHLGMLSSVLALAWAVSGALVGAWSDRRGQRKPLLIVAVILFS
LCSALSGLVGGFLSLLLFRGIMGLAEGPILPLSQSLMVEASSPHRRGLNMGLLQGSAAGL
LGAVIGPPLLVALAETLGWRHAFIVSLLPGLLIAWLIWRHVRPDPPRAQRPAPRAEEAKG
KRLALLKSRNILLCTLISCVFVTWFIVLISFTPTFLVNARGFSPATMGRLMSCLGVAWVV
WGFAVPAISDRIGRRPTLVAFSLLAACCPLALLYAPNATSLGLLLLLTYTGLGCFTLFMA
TIPAETVSRGVIATALGLIMGLGELVGGFLAPTVAGFAADRFGLSIVMWMSCGGALLAAF
LSLFLRETAPAVLARQRSAPTSVLQGNQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgatcgatcagggcaagatcgaagaagccaaagccgcgctgcaggcagcgctc
agcacgctggtcgagacgcgcagcgtgcatccgctgcccgccctgcgcgccaggctgctc
ctgaagcgcgccgagaccttggtagaagatggtcagcggagcgaagcgtccaatgagcgc
ctggagacattattgaacgaagcgcggcagcagttggcctggcggacgcgcgcctccccg
ccggccggcccgcccggcctggagaccgacatggcgcataacaacaattccgccagttac
gaaaacgtcctgctctgcgtgctgttcctgaccttcggcttcgtcttcttcgaccgcctg
gcgctgtccttcctgtttcccttcatggaacaggagctgcaactgagcaacagccacctg
ggcatgctctcctcggtgctggccctggcctgggcggtatccggcgcgctggtcggcgcc
tggtccgaccgccgcgggcagcgcaagccgctgctgatcgtggcggtgatcctgttctcg
ctgtgctcggcgctgtccgggctggtcggcggcttcctcagcctgctgctgttccgcggc
atcatgggcctggccgaggggccgatcctgccgctctcgcaatcgctgatggtcgaggcc
tcctcgccacatcgccgcggcctcaacatgggtctgctacagggctcggcggccggcctg
ctcggcgcggtgatcggcccgccgctgctggtggccctggccgaaaccctcggctggcgt
cacgccttcatcgtctcgttgctgccgggcctgctgatcgcctggttgatctggcgccat
gtgcgtcccgacccgccccgcgcgcagcgcccggcgccgcgcgcagaagaagcgaaaggc
aagcgcctggcactgctgaagagccgcaacatcctgctctgcaccctgatcagttgcgta
ttcgtcacctggttcatcgtgctgatttcctttaccccgaccttcctggtcaacgcccgc
ggcttcagcccggcgaccatgggcaggctgatgagctgcctgggcgtcgcctgggtggtc
tggggcttcgccgtaccggcgatatccgatcgcatcggccgtcgaccgaccctggtggcg
ttctccctgctcgccgcgtgttgcccgctggcgctgctctatgcgccgaacgcgaccagc
ctcggcctgctgttgctgctgacctacaccgggctcggctgcttcaccctgttcatggcg
accatcccggcggagaccgtctcgcgcggcgtcatcgccaccgccctcggcctgatcatg
ggcctcggcgaactggtcggcggtttcctcgcgccgaccgtggccggcttcgccgccgac
cgcttcggcctgtccatcgtcatgtggatgtcctgcggcggcgccctgctcgccgcgttc
ctctcgctgttcctgcgcgaaaccgcgcccgccgtgctggcgcgccagcgcagcgcgcct
acctccgtcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system