KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_2704Help
Entry
N297_2704         CDS       T03097                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00020  Citrate cycle (TCA cycle)
paev00480  Glutathione metabolism
paev01100  Metabolic pathways
paev01110  Biosynthesis of secondary metabolites
paev01120  Microbial metabolism in diverse environments
paev01130  Biosynthesis of antibiotics
paev01200  Carbon metabolism
paev01210  2-Oxocarboxylic acid metabolism
paev01230  Biosynthesis of amino acids
Module
paev_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paev_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N297_2704
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    N297_2704
Enzymes [BR:paev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     N297_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AGY68660
LinkDB All DBs
Structure
PDB: 

Position
2967156..2969381
Genome map
AA seq 741 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEAD
QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEE
KEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLSLQEGEVLDSMFMSCGKLRDFFEKTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLADGSVLMQHKVETGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSH
FYLAMYWAQALAAQNEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNP
ELTSKVMRPSATFNAAIDSLA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcgctcgccacc
tactcgctcctccccatcgtcaaggcctttgccgcttccgccggcatcgacgtcgagacc
agcgacatctctcttgcaggacgcatcctggccaacttcgccgaccgcctcgaagccgac
cagcgtatcgaagacgacctcgcccgcctggcggtcctggccacctcgcccgacgccaat
atcatcaagctgcccaacatcagcgcctcggtgccccagctgaaaggcgcgatcgccgag
ctgcagggcctgggctacaaggttcccgacttcccggaagacccgcagaccgacgaagag
aaagaggttcgcgcacgctacgcgaagatcctcggcagcgccgtgaacccggtcctgcgc
gaaggcaattccgaccgtcgcgcgcctgccgcagtgaaggcctacgcccgcaagcacccg
cactccatgggcaagtggagcatggcctcgcgctcccacgccgactacatgcgcggcggc
gacttcttctccagcgaacagtccatcaccatggccaaggccggtgacgtgcgcatcgaa
ttcgtcggcaaggacggcaaggtcgaggtcaagaagcaactgagcctgcaggaaggcgaa
gtgctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atttcccacccgatcgtcttcggacatgcggtgagcgtctactacaaggacgtcttcgac
aagtggggccaactcttcgaagagctcggcgtgaacccgaacaacggtatctccagcgtc
tacgacaagatcaagtcgctgcccgcctcccagcaggaagagatcctccacgacatccac
gaggtgtacagccaccgcccggaaatggcgatggtcgactccgtgaaaggcatcaccaac
ctgcacattccgagcgacgtcatcgtcgacgcctcgatgccggcgatgatccgcaactcc
ggccagatgtggggcaaggacggcaagcagaaagacaccaaggcggtaatgccggaaagc
acctacgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgac
ccgaccaccatgggcagcgtgccgaacgtcggcctgatggcgcagaaggccgaggaatac
ggctcccacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtggtcctggcc
gacggcagcgtgctgatgcagcacaaggtggagaccggcgacatctggcgcgcctgccag
accaaggacgcgccgatccgcgactgggtcaagctggccgtcacccgcgcacgccagtcc
gataccccggcgatcttctggctggacccggagcgcgcccacgaccgcgaactgcgcaag
aaggtcgagctgtacctcaaggaccacgacctgaccggtctcgacatcagcatcatgggc
tacaacgaggccattcgcgtcagcatggaacgcctgatccgcggcaaggacaccatctcg
gtgaccggcaacgtcctgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acctcggccaagatgctctccatcgttccgctgatggcgggcggcggcatgtacgaaacc
ggcgccggcggctcggcacccaagcacgtccagcaactggtggaagagaactacctgcgc
tgggactccctgggcgagttcctggccctggccgtgtccctggaggaaaccgggatcaag
accggcaacgccaaggccaagctgctcggcaaggcgctggacgaagccaccggcaagctg
ctggacaacaacaagtcgccgtcgcgcaaggtcggcgacatcgacaaccgcggcagccac
ttctacctggcgatgtactgggcccaggccctggccgcccagaacgaagacgctgagctg
aaagcgcacttcgcaccgctggccaaggccctgaccgagcaggaagcgaccatcgtcgcc
gaactcaatgcggtccagggcaagccggccgagatcggcggctactatcgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgcggcgatcgacagcctg
gcctga

DBGET integrated database retrieval system