KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_4226Help
Entry
N297_4226         CDS       T03097                                 

Definition
(GenBank) sugar (and other) transporter family protein
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Nuc_H_symport LacY_symp
Motif
Other DBs
NCBI-ProteinID: AGY71982
LinkDB All DBs
Position
4578249..4579508
Genome map
AA seq 419 aa AA seqDB search
MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLSLLLFRGIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPLLVALAEALGWRHAFIVSLLPG
LLIAWLIWRHVRPDPPRAQRPAPRAEEAKGKRLALLKSRNILLCTLISCVFVTWFIVLIS
FTPTFLVNARGFSPATMGRLMSCLGVAWVVWGFAVPAISDRIGRRPTLVAFSLLAACCPL
ALLYAPNATSLGLLLLLTYTGLGCFTLFMATIPAETVSRGVIATALGLIMGLGELVGGFL
APTVAGFAADRFGLSIVMWMSCGGALLAAFLSLFLRETAPAVLARQRSAPTSVLQGNQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacaacaattccgccagttacgaaaacgtcctgctctgcgtgctgttcctg
accttcggcttcgtcttcttcgaccgcctggcgctgtccttcctgtttcccttcatggaa
caggagctgcaactgagcaacagccacctgggcatgctctcctcggtgctggccctggcc
tgggcggtatccggcgcgctggtcggcgcctggtccgaccgccgcgggcagcgcaagccg
ctgctgatcgtggcggtgatcctgttctcgctgtgctcggcgctgtccgggctggtcggc
ggcttcctcagcctgctgctgttccgcggcatcatgggcctggccgaggggccgatcctg
ccgctctcgcaatcgctgatggtcgaggcctcctcgccacatcgccgcggcctcaacatg
ggtctgctacagggctcggcggccggcctgctcggcgcggtgatcggcccgccgctgctg
gtggccctggccgaagccctcggctggcgtcacgccttcatcgtctcgttgctgccgggt
ctgctgatcgcctggttgatctggcgccatgtgcgtcccgacccgccccgcgcgcagcgc
ccggcgccgcgcgcagaagaagcgaaaggcaagcgcctggcactgctgaagagccgcaac
atcctgctctgcaccctgatcagttgcgtattcgtcacctggttcatcgtgctgatttcc
tttaccccgaccttcctggtcaacgcccgcggcttcagcccggcgaccatgggcaggctg
atgagctgcctgggcgtcgcctgggtggtctggggcttcgccgtaccggcgatatccgat
cgcatcggccgtcgaccgaccctggtggcgttctccctgctcgccgcgtgttgcccgctg
gcgctgctctatgcgccgaacgcgaccagcctcggcctgctgttgctgctgacctacacc
gggctcggctgcttcaccctgttcatggcgaccatcccggcggagaccgtctcgcgcggc
gtcatcgccaccgccctcggcctgatcatgggcctcggcgaactggtcggcggtttcctc
gcgccgaccgtggccggcttcgccgccgaccgcttcggcctgtccatcgtcatgtggatg
tcctgcggcggcgccctgctcgccgcgttcctctcgctgttcctgcgcgaaaccgcgccc
gccgtgctggcgcgccagcgcagcgcgcctacctccgtcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system