KEGG   Pseudomonas aeruginosa PAO1-VE13: N297_5608Help
Entry
N297_5608         CDS       T03097                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
paev  Pseudomonas aeruginosa PAO1-VE13
Pathway
paev00010  Glycolysis / Gluconeogenesis
paev01100  Metabolic pathways
paev01110  Biosynthesis of secondary metabolites
paev01120  Microbial metabolism in diverse environments
paev01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N297_5608
Enzymes [BR:paev01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     N297_5608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGY71165
LinkDB All DBs
Position
6103201..6104118
Genome map
AA seq 305 aa AA seqDB search
MNTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQPPLVWLSDEAGYR
RGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDWKIDDIAEEDGDLC
VSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLSQALHTYFAVSDSR
EIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLIKDPRWERSIHLHA
LDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAPGRSESFGVQIWSE
PLKRP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatagcccgatcaaccgcgtcgaacaggtacaggtcgacgacctggcctgc
tggcgcatccacaccgcccatggcgaggcgctgatcgcccagcagggcgcgcaactgctc
agctaccagccccacgaacagccgccgctggtctggctcagcgacgaggccggctaccgg
cgcgggcagtcggtacgcggcggggtgccggtgtgctggccgtggttcggtccgctggag
cgcaacccgcaggaagtccgcggccaggtggaagatggcctgaaggcgcccgcccacggg
ctggtccgggcagtcgactggaaaatcgacgacatcgccgaggaggacggcgacctctgc
gtcagcttccgcctcgacgcccccgatggcctccccggctggccgcacccggcggcgctg
cgcatgctgttccgcttcggcgagcgcctgaccctgcgactcaccagcgagaacctcggc
agcaagccgctggtgctcagccaggcactgcacacctacttcgcggtcagcgacagccgc
gagatcgccatcgagggcctggaaggcgcgcgctacatcgagaccctggagaactgggaa
gaacgcactcagcacggcgcggtacgggtcaagggcgaactggatcgcatctacctcggt
ctcgaacgcgacctgctgatcaaggacccgcgctgggaacgcagcatccacctgcacgcc
ctcgactcgcgctcggcggtggtctggaacccctgggtggacaagtcccggcgtctctcg
cagttcgccgacgacgcctggcagcagatgctctgcatcgagaccgggcgggtctgggac
gacctcatggtggtcgcccccgggcgcagcgaaagctttggcgtgcagatctggagcgag
ccgctgaaacgaccctga

DBGET integrated database retrieval system