KEGG   Pseudomonas aeruginosa M18: PAM18_0844Help
Entry
PAM18_0844        CDS       T01973                                 

Definition
(GenBank) putative major facilitator superfamily (MFS) transporter
Organism
paf  Pseudomonas aeruginosa M18
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Nuc_H_symport LacY_symp
Motif
Other DBs
NCBI-ProteinID: AEO73331
LinkDB All DBs
Position
complement(929805..931064)
Genome map
AA seq 419 aa AA seqDB search
MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLSLLLFRGIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPLLVALAEALGWRHAFIVSLLPG
LLIAWLIWRHVRPDPPRAQRPAPRAEEAKGKRLALLKSRNILLCTLISCVFVTWFIVLIS
FTPTFLVNARGFSPATMGRLMSCLGVAWVVWGFAVPAISDRIGRRPTLVAFSLLAACCPL
ALLYAPNATSLGLLLLLTYTGLGCFTLFMATIPAETVSRGVIATALGLIMGLGELVGGFL
APTVAGFAADRFGLSIVMWMSCGGALLAAFLSLFLRETAPAVLARQRSAPTSVLQGNQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacaacaattccgccagttacgaaaacgtcctgctctgcgtgctgttcctg
accttcggcttcgtcttcttcgaccgcctggcgctgtccttcctgtttcccttcatggaa
caggagctgcaactgagcaacagccacctgggcatgctctcctcggtgctggccctggcc
tgggcggtatccggcgcgctggtcggcgcctggtccgaccgccgcgggcagcgcaagccg
ctgctgatcgtggcggtgatcctgttctcgctgtgctcggcgctgtccgggctggtcggc
ggcttcctcagcctgctgctattccgcggcatcatgggcctggccgaggggccgatcctg
ccgctctcgcaatcgctgatggtcgaggcctcctcgccgcatcgccgcggcctcaacatg
ggcctgctacagggctcggcggccggcctgctcggcgcggtgatcggcccgccgctgctg
gtggccctggccgaagccctcggctggcgtcacgccttcatcgtctcgttgctgccgggt
ctgctgatcgcctggttgatctggcgccatgtgcgtcccgacccgccccgcgcgcagcgc
ccggcgccgcgcgcagaagaagcgaaaggcaagcgcctggcactgctgaagagccgcaac
atcctgctctgcaccctgatcagttgcgtattcgtcacctggttcatcgtgctgatttcc
tttaccccgaccttcctggtcaacgcccgcggcttcagcccggcgaccatgggcaggctg
atgagctgcctgggcgtcgcctgggtggtctggggcttcgccgtaccggcgatatccgat
cgcatcggccgtcgaccgaccctggtggcgttctccctgctcgccgcgtgttgcccgctg
gcgctgctctatgcgccgaacgcgaccagcctcggcctgctgttgctgctgacctacacc
gggctcggctgcttcaccctgttcatggcgaccatcccggcggagaccgtctcgcgcggc
gtcatcgccaccgccctcggcctgatcatgggcctcggcgaactggtcggcggtttcctc
gcgccgaccgtggccggcttcgccgccgaccgcttcggcctgtccatcgtcatgtggatg
tcctgcggcggcgccctgctcgccgcgttcctctcgctgttcctgcgcgaaaccgcgccc
gccgtgctggcgcgccagcgcagcgcgcctacctccgtcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system