KEGG   Pseudomonas aeruginosa M18: PAM18_0846Help
Entry
PAM18_0846        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AEO73333
LinkDB All DBs
Position
931987..932946
Genome map
AA seq 319 aa AA seqDB search
MPAHALLETRRASTQDIPLEQRLAFWEDYNASILVGLKCSSYSQAGFAATQDNLCLERLR
LARIGGNEHVVERDRSMIRAVPKESIFVSLVQGSQSFFYQDNGCNLLQPGELVIYRTDKP
YLFGFSGPMRQFIFDIPQDDFAERCLRDFKGPLKIGAESPVQRLLVRTLGERTRDFLDSP
HGEDAERYQEEAYDLLASIISDHAGEHRASALGASYLLAAKQYIQQHLDEPALSCERVAA
ATGVSSRHLARLFAQEGSSPGRYLQERRLERARQLLASPQGRRLDVAEVAYRHGFSSQAH
FARAFKARYGMTPSEARGR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacatgccttgctcgaaacccggcgggccagcacccaggacattcccctggag
cagcggctggcgttctgggaggactacaacgcttccatcctggttggcctgaaatgttcg
tcgtattcccaggccggcttcgccgcgacccaggacaacctctgcctcgaacgcctgcgg
ctggcccgcatcggcggcaacgagcacgtggtggagcgcgaccgctcgatgatccgcgca
gtgcccaaggagtcgatcttcgtctccctggtgcagggcagccagtcgttcttctaccag
gacaacggctgcaacctcctgcaaccgggcgagctggttatctaccggaccgacaagccc
tacctgttcggtttttccggaccgatgcggcagttcatcttcgacattccccaggacgat
ttcgccgagcgctgcctgcgcgacttcaagggaccgctgaagatcggcgcggaaagcccg
gtgcagcgcctgctggtgcggaccctcggcgagcgtacccgggatttcctcgacagcccc
catggcgaggatgccgagcgctaccaggaggaagcctacgacctgctggcgagcatcatc
agcgaccatgccggcgagcaccgtgccagcgccctgggcgcgtcctacctgctggcggcc
aagcagtacatccagcagcatctcgacgaacccgccctgagctgcgagcgggtggccgcc
gccactggcgtctccagccggcacctggcgcggctgttcgcccaggaaggcagctcgccc
gggcgctacctgcaggagcggcgcctggagcgggcccgccagttgctcgcttcgccccag
ggccggcgcctggatgtcgccgaggtcgcctatcgccacggcttctccagccaggcgcat
ttcgcccgggccttcaaggcgcgctacgggatgacgccgagcgaggcgcgtggccgctag

DBGET integrated database retrieval system