KEGG   Pseudomonas aeruginosa M18: PAM18_1301Help
Entry
PAM18_1301        CDS       T01973                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00061  Fatty acid biosynthesis
paf00780  Biotin metabolism
paf01100  Metabolic pathways
paf01212  Fatty acid metabolism
Module
paf_M00083  Fatty acid biosynthesis, elongation
paf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAM18_1301 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAM18_1301 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paf01004]
    PAM18_1301 (fabZ)
Enzymes [BR:paf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PAM18_1301 (fabZ)
Lipid biosynthesis proteins [BR:paf01004]
 Fatty acid synthase
  Component type
   PAM18_1301 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AEO73788
LinkDB All DBs
Structure
PDB: 

Position
1424519..1424959
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVKRSI
WKFDCHATVDDKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcatcgctatcctttcctgctggtg
gatcgggtggtagagctggacatcgagggcaagcgcattcgcgcctacaagaatgtcagt
atcaatgagccgttcttcaacggacatttccccgagcacccgatcatgccgggcgtgctg
atcatcgaggcgatggcccaggcggccggtatcctcggtttcaagatgctcgacgtgaag
cccgccgacggcaccctttactacttcgtcggttcggacaagctgcgcttccgccagccg
gtcctgccgggcgaccaactgcaactgcacgccaagttcatcagcgtgaagcgcagcatc
tggaaattcgactgccacgctaccgtcgacgacaagccggtatgctcggctgaaatcatc
tgtgcggaacgcaaactatga

DBGET integrated database retrieval system