KEGG   Pseudomonas aeruginosa M18: PAM18_2351Help
Entry
PAM18_2351        CDS       T01973                                 

Gene name
idh
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00480  Glutathione metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01200  Carbon metabolism
paf01210  2-Oxocarboxylic acid metabolism
paf01230  Biosynthesis of amino acids
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_2351 (idh)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAM18_2351 (idh)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PAM18_2351 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AEO74834
LinkDB All DBs
Structure
PDB: 

Position
complement(2551112..2553337)
Genome map
AA seq 741 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEAD
QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEE
KEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLSLQEGEVLDSMFMSCGKLRDFFEKTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLADGSVLMQHDVETGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSH
FYLAMYWAQALAAQDEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNP
ELTSKVMRPSATFNAAIDSLA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcgctcgccacc
tactcgctcctccccatcgtcaaggcctttgccgcttccgccggcatcgacgtcgagacc
agcgacatctctcttgcaggacgcatcctggccaacttcgccgaccgcctcgaagccgac
cagcgtatcgaagacgacctcgcccgcctggcggtcctggccacctcgcccgacgccaat
atcatcaagctgcccaacatcagcgcctcggtgccccagctgaaaggcgcgatcgccgag
ctgcagggcctgggctacaaggttcccgacttcccggaagacccgcagaccgacgaagag
aaagaggttcgcgcacgctacgcgaagatcctcggcagcgccgtgaacccggtcctgcgc
gaaggcaattccgaccgtcgcgcgcctgccgcagtgaaggcctacgcccgcaagcacccg
cactccatgggcaagtggagcatggcctcgcgctcccacgccgactacatgcgcggcggc
gacttcttctccagcgaacagtccatcaccatggccaaggccggtgacgtgcgcatcgaa
ttcgtcggcaaggacggcaaggtcgaggtcaagaagcaactgagcctgcaggaaggcgaa
gtgctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atttcccacccgatcgtcttcggacatgcggtgagcgtctactacaaggacgtcttcgac
aagtggggccaactcttcgaagagctcggcgtgaacccgaacaacggtatctccagcgtc
tacgacaagatcaagtcgctgcccgcctcccagcaggaagagatcctccacgacatccac
gaggtgtacagccaccgcccggaaatggcgatggtcgactccgtgaaaggcatcaccaac
ctgcacattccgagcgacgtcatcgtcgacgcctcgatgccggcgatgatccgcaactcc
ggccagatgtggggcaaggacggcaagcagaaagacaccaaggcggtaatgccggaaagc
acctacgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgac
ccgaccaccatgggcagcgtgccgaacgtcggcctgatggcgcagaaggccgaggaatac
ggctcccacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtggtcctggcc
gacggcagcgtgctgatgcagcacgacgtggagaccggcgacatctggcgcgcctgccag
accaaggacgcaccgatccgcgactgggtcaagctggccgtcacccgcgcacgccagtcc
gataccccggcgatcttctggctggacccggagcgcgcccacgaccgcgaactgcgcaag
aaggtcgagctgtacctcaaggaccacgacctgaccggtctcgacatcagcatcatgggc
tacaacgaggccattcgcgtcagcatggaacgcctgatccgcggcaaggacaccatctcg
gtgaccggcaacgtcctgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acctcggccaagatgctctccatcgttccgctgatggcgggcggcggcatgtacgaaacc
ggcgccggcggctcggcacccaagcacgtccagcaactggtggaagagaactacctgcgc
tgggactccctgggcgagttcctggccctggccgtgtccctggaggaaaccgggatcaag
accggcaacgccaaggccaagctgctcggcaaggcgctggacgaagccaccggcaagctg
ctggacaacaacaagtcgccgtcgcgcaaggtcggcgacatcgacaaccgcggcagccac
ttctacctggcgatgtactgggcccaggccctggccgcccaggacgaagacgccgaactg
aaagcgcacttcgcaccgctggccaaggccctgaccgagcaggaagcgaccatcgtcgcc
gaactcaatgcggtccagggcaagccggccgagatcggcggctactatcgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgcggcgatcgacagcctg
gcctga

DBGET integrated database retrieval system