KEGG   Pseudomonas aeruginosa M18: PAM18_3155Help
Entry
PAM18_3155        CDS       T01973                                 

Gene name
polB
Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:paf03400]
    PAM18_3155 (polB)
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PAM18_3155 (polB)
DNA repair and recombination proteins [BR:paf03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    PAM18_3155 (polB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 P63C
Motif
Other DBs
NCBI-ProteinID: AEO75638
LinkDB All DBs
Position
complement(3522971..3525337)
Genome map
AA seq 788 aa AA seqDB search
MVELLQGFVLTRHWRDTPAGTEVAFWLATEQGPRQVRLPPQPSVAFVLAEQRGRVESLLA
GETGAELRPLALRDFQQRPVLGLYCQQHRQLMNLEKRLRQAGVEVFEADIRPPERYLMER
FITAPVSLEASVEADGSLLARRLKPAPDYRPRLRLVSLDIETNARGDLYSIALEGCGQRQ
VYMLGPANGDAAAVDFRLDYCDSRAGLLERLNQWLAEHDPDAIIGWNLVQFDLRVLHEHA
QRLKVPLRLGRGGDEMGWREHGSRNNHFFAAAAGRLIIDGIEALRSATWSFPSFSLENVA
RTLLGEGKAIDNPYQRMDEIDRMFAEDKPALAHYNLKDCELVTRIFARTELLDFLLERAT
VTGLPADRSGGSVAAFTHLYMPLMHRAGFVAPNLGEKRPEASPGGFVMDSRPGLYESVLV
LDYKSLYPSIIRTFLIDPVGLVEGLRQPDDEHSVEGFRGARFSRTRHCLPAIVARVWEGR
EAAKRERNQPLSQALKIIMNAFYGVLGSSGCRFFDPRLASSITLRGHRIMRRTRELIEAE
GYTVIYGDTDSTFVWLGSPRAEEEAAAIGRALVARVNDWWREHLKEEFGLDSALELQFET
HYRRFLMPTVRGAEEGSKKRYAGLVRRADGGEEMVFKGLETVRTDWSPLAQRFQQELYLR
IFNRQPYQDYVRDYVRRTLAGELDDLLVYRKRLRRRLDDYQRNVPPHVRAARIADDYNLE
RGRPRQYQSGGWISYVISVAGPEPLEARRSAIDYEHYVGKQLQPVADAILPFVGDDFATL
VDRQMALF
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggtggagttactgcaagggttcgtcctgacccggcactggcgcgatacgccggccggc
acggaagtcgcgttctggctggcgaccgagcagggcccgcggcaggtgcggctgccgccg
cagccgtcggtggcgttcgtcctcgccgagcagcgcgggcgcgtcgagtccctgctcgcc
ggggagactggcgccgagctgcggccgctggcgctgcgcgacttccagcagcggccggtg
ctcggcctgtactgccagcagcatcgccaactgatgaatctggagaaacgcttgcgccag
gccggcgtcgaggtgttcgaggccgatatccggccgccggagcgctacctgatggagcgc
ttcatcaccgcgccggtcagcctggaggcgagtgtcgaggctgacggcagcctgctcgcc
cggcgcctgaagccggctccggactatcgcccgcgcctgcgcctggtgtcgctggacatc
gagaccaacgcccgcggcgatctctactccatcgccctggaaggctgcggccagcgccag
gtatacatgctcggcccggccaacggcgatgccgcggccgtggatttccgcctcgactat
tgcgacagccgtgccgggctgctggaacgtctcaaccagtggctggccgagcacgatccc
gacgccatcatcggctggaacctggtgcagttcgacctgcgcgtcctgcatgagcatgcc
cagcgcctgaaggtgccgctgcgcctggggcgtggcggcgacgaaatgggctggcgcgag
cacggcagccgcaacaaccactttttcgccgcggcggccggccgcctgatcatcgatggc
atcgaggcgctgcgctcggcgacctggagcttcccctcgttcagcctggagaacgtcgcc
cggaccctgctcggcgaaggcaaggcgatcgacaatccataccagcggatggacgagatc
gatcgcatgttcgccgaggacaagccggccctcgcgcactacaacctgaaggactgcgaa
ctggtgacgcggatcttcgcccgtaccgaactgctcgacttcctcctcgaacgggccacc
gtcaccggcctgccggcggaccgcagcggcggctcggtggcggccttcacccacctgtac
atgccgttgatgcaccgcgccggcttcgtcgccccgaacctcggcgagaagcgcccggaa
gccagtcccggcggcttcgtcatggactcgcggccgggcctctacgaatcggtgctggtg
ctcgactacaagagcctgtatccgtcgatcatccgtaccttcctgatcgacccggtcggc
ctggtggaaggcctgcgccagccggacgacgagcactcggtggaaggttttcgcggcgcc
cgcttctcgcgtacccggcattgcctgccggccatcgtcgcacgggtctgggagggccgc
gaggcggccaagcgcgaacgcaaccagccgctctcgcaggcgttgaagatcatcatgaac
gccttctacggggtgctgggttccagcggctgccgcttcttcgacccgcgcctggcctcg
tccatcaccctgcgcgggcatcggatcatgcgccgtacccgcgagctgatcgaggccgag
ggctatacggtgatctatggcgataccgactccaccttcgtctggctcggcagcccccgc
gccgaggaggaggccgcggccatcggccgggcgctggtggcgcgggtcaacgactggtgg
cgcgagcacctgaaagaagaattcggcctcgacagcgccctcgagctgcaattcgagacc
cattaccggcgttttctcatgcccaccgtgcgcggcgccgaggagggcagcaagaaacgc
tacgccggcctggtgcgccgcgccgacggtggcgaggagatggtcttcaagggcctggag
accgtgcgcaccgactggtcgccgctggcccagcgcttccagcaggaactctacctgcgc
atcttcaatcgccagccctaccaggactacgtgcgcgattacgtacgacggaccctggcc
ggcgagctggacgacctgctggtctaccgcaagcgcctgcgccggcgcctcgacgattac
cagcgcaacgtgccgccgcatgtgcgcgcggcgcgcatcgccgacgactacaacctcgag
cgcgggcgcccgcggcagtaccagagcggcggctggatcagctacgtgatcagcgtcgcc
ggtcccgagccgctcgaggcgcggcgttcggccatcgactacgagcactacgtgggcaag
cagttgcagccggtggccgacgccatcctgccgttcgtcggcgacgatttcgccaccctg
gtcgaccggcagatggcgctgttctga

DBGET integrated database retrieval system