KEGG   Pseudomonas aeruginosa LESB58: PLES_03911Help
Entry
PLES_03911        CDS       T00818                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00330  Arginine and proline metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01130  Biosynthesis of antibiotics
pag01230  Biosynthesis of amino acids
Module
pag_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PLES_03911 (proC)
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PLES_03911 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N PDH ApbA OCD_Mu_crystall GFO_IDH_MocA UDPG_MGDP_dh_C Shikimate_DH IlvN Crp
Motif
Other DBs
NCBI-ProteinID: CAW25118
LinkDB All DBs
Position
complement(428571..429392)
Genome map
AA seq 273 aa AA seqDB search
MSTPRIAFIGAGNMAASLIGGLRAQGVPAAQIRASDPGAEQRAKIAGEFAIDVVESNAEA
VADADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMP
NTPALLRQGASGLYANAQVSAAQREQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYF
FLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAA
IKSFQANGFEALVEQALNAASQRSAELAEQLGQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccccgcatagcgttcatcggcgccggcaacatggccgccagcctgatcggc
ggcctgcgcgcccaaggcgtgccggcggcgcagatccgcgccagcgacccgggcgccgag
caacgcgcgaagatcgccggcgagttcgccatcgacgtggtcgagtccaacgccgaggcc
gtggccgacgccgacgtcgtggtcctgtcggtcaagccgcaggccatgaaagccgtgtgc
caggccttggcgccggcgctgaagccggagcaactgatcgtctccatcgccgccggcatc
ccctgcgccagcctcgaagcctggctcggccagccgcgcccggtggtccgctgcatgccc
aacaccccggcgctgctgcgccagggcgccagcgggctgtacgccaacgcgcaggtcagc
gccgcgcaacgcgagcaggccgggcagttgctgtccgcggtgggcatcgccctgtggctg
gacgacgaagcgcagatcgacgcggtgaccgcagtgtcgggcagcggcccggcgtatttc
ttcctgctgatgcaggccatgaccgacgccggcgagaagctcggcctgtcccgcgagaca
gcctcgcgcctgaccctgcagaccgccctcggcgcggcgcagatggcgctgtccagcgag
gtcgagccggccgaactgcggcgccgggtgacttcgcccaacggcaccaccgaggcggcg
atcaaatccttccaggccaacggcttcgaagcactggtggagcaggccctgaacgccgcc
agccagcgctccgccgagctggccgaacagcttggccaataa

DBGET integrated database retrieval system