KEGG   Pseudomonas aeruginosa LESB58: PLES_24791
Entry
PLES_24791        CDS       T00818                                 

Gene name
trmU
Definition
(GenBank) tRNA methyltransferase
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    PLES_24791 (trmU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pag03016]
    PLES_24791 (trmU)
Enzymes [BR:pag01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     PLES_24791 (trmU)
Transfer RNA biogenesis [BR:pag03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    PLES_24791 (trmU)
SSDB
Motif
Pfam: tRNA_Me_trans NAD_synthase ThiI QueC ATP_bind_3 Asn_synthase
Other DBs
NCBI-ProteinID: CAW27205
UniProt: B7UV15
LinkDB
Position
complement(2667083..2668210)
AA seq 375 aa
MSESAPTPRRERVIVGMSGGVDSSVSALLLLQQGYQVEGLFMKNWDEDDGTEYCTAREDL
ADAQAVCDRIGIKLHTANFAAEYWDNVFEHFLAEYKAGRTPNPDILCNREIKFKAFLDYA
LMLGADLIATGHYVRRRDRDGRTELLKGLDPNKDQSYFLHAVGGEQIARSLFPVGELEKP
EVRAIAEKHGLATAKKKDSTGICFIGERRFTDFLKQYLPAQPGDIETIEGKVIGRHSGLM
YHTIGQRQGLGIGGLKEAGDDPWYVLGKDLQRNVLLVGQGNDHPLLFSRALLASRIYWVN
PVELERPRRLRAKVRYRQSDQDCVLEKTAEGYRAVFDEPQRAVTPGQSVVFYDGDVCLGG
GVIETAEAWDFGGRP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtctgaatccgcccccaccccacgccgcgagcgcgtgatcgtcggcatgtccggcggc
gtcgactcgtccgtctccgccctgctcctgttgcagcagggctatcaggtcgaaggcctg
ttcatgaagaactgggacgaggacgacggcaccgaatactgtaccgcccgcgaggacctg
gccgacgcccaggccgtctgcgaccggatcggcatcaagctgcacacggcgaacttcgcc
gcggaatactgggataacgtgttcgagcacttccttgccgagtacaaggccggccgtacg
ccgaacccggacatcctctgcaaccgcgaaatcaagttcaaggcgttcctcgactacgcg
ctgatgctcggcgcggacctgatcgccaccggccactatgtgcggcgccgcgaccgcgac
gggcgcaccgagctgctcaagggcctggacccgaacaaggaccagagctacttcctgcac
gcggtgggcggcgagcagatcgcccgcagcctgttccccgtcggcgaactggagaagccg
gaagtccgcgccatcgccgagaagcatggcctcgccacggcgaagaagaaggactccacg
ggcatctgcttcattggcgagcgacgcttcaccgatttcctcaagcagtacctgccggcc
cagccgggcgacatcgagaccatcgaaggcaaggtcatcggtcgccacagcggcctgatg
taccacaccatcggccagcgccagggcctcggcatcggcggtctcaaggaagccggcgac
gatccctggtacgtgctcggcaaggacctgcaacgcaacgtgctgctggtcggccagggc
aacgaccacccgctgctgttctcccgcgccctgctggcctcgcgaatctactgggtcaac
ccggtcgaactggagcggccgcgccgcctgcgggccaaggtgcgctaccgccagagcgac
caggactgcgtcctggagaaaaccgccgaaggctaccgcgcggtgttcgacgaaccgcag
cgcgcggtgaccccggggcaatcggtggtgttctacgacggcgacgtctgcctcggcggc
ggcgtgatcgaaacggcggaagcctgggatttcggaggacgcccgtga

DBGET integrated database retrieval system