KEGG   Pseudomonas aeruginosa LESB58: PLES_31741Help
Entry
PLES_31741        CDS       T00818                                 

Definition
(GenBank) probable trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00500  Starch and sucrose metabolism
pag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PLES_31741
Enzymes [BR:pag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PLES_31741
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PLES_31741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: CAW27901
LinkDB All DBs
Position
complement(3501098..3504400)
Genome map
AA seq 1100 aa AA seqDB search
MARREKPVFLNDPQWYKDAVIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLKRIRAE
LDAHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQEDRYPI
TDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGIRRRLA
PLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGF
SRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQKAFGRGSLKML
APSNRRILAYLREYAEGERQDSILCVANLSRAAQAVELDLASHAGKVPVEMIGGMSFPPI
GELTYLLTLPPYGFYWFYLADATQMPSWHVAADERLPELPTLVVKQRLGELLQGASRNIL
EGETLPAYLPKRRWFAGEKGQPRLCYIVPLDEAEPRCALCEVEIDGLRYQLPLGFLDADQ
RGDSLPQLLALARLRRGRKVGLLTDAASLPLFARKVLAQLRAEAVIAHGDGEIQFIPAAG
LAEMDDIADEDVLPFSVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRHGYPGI
APLLGEVRRVGADGEPHTLMILQGYLNNQGDAWNWTLDNLERAVRDEISAASEALEGQYD
SLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDEASVQAWALRIAEQLREAGKRL
SEPPRPLQGEAAEQARRLLERLPALLERLPLLARQAAGGLLIRVHGDLHLGQVLMVQGDA
RFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADSARRKV
AMRYRSEARDAFLAGYRAAAAGLMHAWHGREGEGAALALACLEKAAYELLYEADYRPDWL
EVPLAGLAELTEHLLKGKNR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaaaccggtctttctcaacgacccgcaatggtacaaggacgcggtg
atctaccaggtccacgtgaaatccttctacgacgccaacaacgatggcatcggcgacttc
gccgggctgatcgagaagctcgactacatcgccgacctcggcgtgaacactctctggctg
ctgccgttctacccgtcgccacgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactacggcagcctcgccgacgcccgccggttcatcgccgaggcccatcga
cgcggtctgcgggtgattaccgagctggtgatcaaccacacctccgaccagcatccctgg
ttcatccgcgcccgccacgcgaagaagggatcgcgcgcccgcgactactacgtctggtcg
gacagcgacgagaaataccagggtacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtagcccaacagtactactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtcctgcgcgaggtgctcggggtgatgcgctactgg
ctggacatgggcgtcgacggcttgcgcctggacgcgattccctacctgatcgaacgcgac
ggcaccagcagcgagaacctgccggagacccaccaggtgctcaagcgcatccgcgccgag
ctggacgcgcactatcccgaccgcatgctgctggccgaggccaaccagtggccggaagac
acccggccgtacttcggcggcgaggatggcggcgagggcgacgaatgccacatggccttc
cacttcccgctgatgccgcgcatgtacatggccatcgcccaggaggatcgctatccgatc
accgacatcctgcgccagaccccggacatcccggccaattgccaatgggcgatcttcctg
cgcaaccacgacgagctgaccctggagatggtcaccgacgacgagcgcgactatctctgg
aaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatccgccggcgcctggcg
ccgctggtggagcgtgaccggcggcgcatcgagctgctgcacagcctgctgttgtcgatg
ccgggcacgccgaccctgtactacggcgacgagatcggcatgggcgacaacatctacctc
ggcgaccgcgacggcgtgcggaccccgatgcagtggtcggtggaccgcaacggcggcttc
tcccgcgccgacccggcgaagctggtgctgccgccgattctcgacccgctgtacggctac
cagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggatgcgc
cgcctgctcgccgtgcgcagccagcagaaggccttcggccgcggcagcctgaagatgctc
gcgccgagcaaccgacggatcctcgcctacctgcgcgaatacgccgagggcgaacggcag
gacagcatcctctgcgtggccaacctgtcgcgcgcggcccaggcggtggaactggacctc
gccagccatgccggcaaggtgccggtggagatgatcggcggcatgtcgttcccgccgatc
ggcgagctgacctacctgctgaccctgccgccctacggcttctactggttctacctggcc
gacgcgacgcagatgccgagctggcacgtggccgccgacgagcgcctgccggaactgccg
accctggtggtcaagcagcgcctcggcgagctgctgcagggcgcatcgcggaacatcctg
gaaggcgagacgctgccggcctacctgccgaagcgccgctggttcgccggcgagaaaggc
cagccacggctctgctacatcgttccgctggacgaggcggagccgcgctgtgcattgtgc
gaagtggagatcgacgggctgcgctaccagttgccgctgggcttcctcgacgccgaccag
cgcggcgacagcctgcctcagttgctggccctggcgcgcctgcggcgcggtcgcaaggtc
ggcctgctgaccgacgccgccagcctgccgctgttcgcccgcaaggtcctcgcgcaactc
cgcgccgaggcggtgatcgcccacggcgacggcgagatccagttcatcccggcggcggga
ctggcggaaatggacgacatcgccgacgaagacgtcctgccgttctcggtggagcagtcc
aacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctgcgcaagatccttccg
gggctgcacccggaaatcgaggtcggcggctacctgacccgccacggctaccccggcatc
gccccgttgctcggcgaggtacggcgggtcggcgcggatggcgagccgcacacgctgatg
atcctgcagggctacctgaacaaccagggcgacgcctggaactggaccctggacaacctg
gagcgagccgtgcgcgacgagatatccgcggccagcgaggcgctcgaagggcaatacgac
agcctcgccgaactgcgcggcttcgccgccaacctcggcgcccggctcggcgagatgcac
agcgtactggccggcgagtcggacgatccggccttcggcagccgcgagagcgacgaagcc
agcgtccaggcctgggcgctgcgcatcgccgaacagttgcgcgaagccggcaaacgcctg
agcgagccgccacggccgttgcagggcgaggcggcggaacaggcgcggcgcctgctggaa
cgcctgccggcgctgctcgaacgcctgccgctgctggcccggcaggcagccggcgggctg
ctgatcagggttcacggcgacctgcacctgggccaggtgctgatggtccagggcgacgca
cgcttcatcgacttcgagggcgagccggcgcgcagcctggaagagcgccgccagcgtcac
agtccgatgaaggacgtcggcggcatgctgcgctcgttcgactacgcggcggcgatggtc
ctgcgcaacgcgcagagcaccgatagctcggaacaggccgacagcgcccggcgcaaggtc
gccatgcgctatcgcagcgaagcccgcgatgccttcctggccggctatcgggccgccgcg
gcgggtctcatgcacgcctggcacggtcgcgaaggcgaaggggcggcgctggccctggcc
tgcctggaaaaggccgcctacgaactgctctacgaagccgactaccgccccgactggctg
gaagtgcctctcgccggtctggccgaactcaccgaacacctcctgaagggcaagaaccga
tga

DBGET integrated database retrieval system