KEGG   Pseudomonas aeruginosa LESB58: PLES_40451Help
Entry
PLES_40451        CDS       T00818                                 

Definition
(GenBank) putative D-amino acid oxidase
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00330  Arginine and proline metabolism
pag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PLES_40451
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     PLES_40451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_3 3HCDH_N FAD_oxidored GIDA ApbA HI0933_like Pyr_redox AlaDh_PNT_C Pyr_redox_3 TrkA_N ThiF UDPG_MGDP_dh_N Epimerase Lycopene_cycl Trp_halogenase Sacchrp_dh_NADP XdhC_C KR
Motif
Other DBs
NCBI-ProteinID: CAW28799
LinkDB All DBs
Position
4463570..4464685
Genome map
AA seq 371 aa AA seqDB search
MNAEVIVVGAGIVGSACAHELARRGLDVLVLDSRRGGATAVGMGHLVAMDDNPAELALSD
YSIQAWRAWAADLPEDCAYRNCGTLWLAADAAELAEAERKRQALLAVGVACEMLDAARLR
DLEPVLRPGLAGALKVPGDGILYAPNAARWLLERAGPRLRRLHAEVSEVDGSRLRLADGR
WLSAEALVLANGIHAGELCAELPIRPKKGHLLITDRYPGTLRHQLVELGYVSSAHASSGT
SVAFNAQPRPTGQIFLGSSRQFDTLDPQVEGPVLARMLRRALNYLPGLAGLNAIRAWTGF
RAATPDGLPLLGEHPAQPGLWLAVGHEGLGVTTAPGSARLLAAQLFGETPPLDPTPYLPQ
RFLSSSGSARP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccgaggtcatcgtggtcggcgccggcatcgtcggcagcgcctgcgcccatgaa
ctggcgcgtcgcggcctcgacgtactggtgctggacagccgccgcggcggtgccaccgcg
gtgggcatgggccatctggtggcgatggacgacaacccggccgaactggccctcagcgac
tactcgatccaggcctggcgcgcctgggcggcggatctgccggaagactgcgcgtaccgc
aattgcggcaccctctggctggccgccgacgccgccgaactcgccgaagccgagcgcaag
cgccaggccctgctggccgtcggcgtcgcctgcgagatgctcgacgccgcgcgcctgcgt
gacctggaaccggtcttgcggccaggcctcgccggcgccctgaaggtgccgggcgacggc
atcctctacgcgcccaacgcggcgcgctggctgctcgaacgagccggcccgcgcctgcgt
cgattgcacgccgaagtcagcgaagtggacggcagccgcctgcgcctggccgacggccgc
tggctgagcgccgaggcgctggtgctggccaacggcatccatgccggcgagctgtgcgcg
gagctgccgatccgcccgaagaaaggccacctgctgatcaccgaccgctatcccggcacc
ctccgccatcaactggtggaactcggctatgtcagcagcgcccacgccagcagcggtacc
tcggtagccttcaacgcccagccgcgccccaccgggcagatcttcctcggctcctcgcgg
cagttcgacacgctcgacccgcaggtggaaggcccggtgctggcgcgcatgctgcggcgt
gccctgaactacctgccggggctcgccggcctcaatgcgatccgtgcctggaccggcttc
cgcgccgccactccggacggcctgccgctgctcggcgagcacccggcgcagccgggcctg
tggctggcggtcggccacgagggcctgggcgtgaccaccgcgccgggcagcgcgcgcctg
ctcgccgcccagttgttcggcgaaacgccgccgctggatcccacgccttatctgccgcaa
cgcttcctctccagctccgggagtgcccggccatga

DBGET integrated database retrieval system