KEGG   Pseudoalteromonas agarivorans: PAGA_b0519Help
Entry
PAGA_b0519        CDS       T06137                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paga  Pseudoalteromonas agarivorans
Brite
KEGG Orthology (KO) [BR:paga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAGA_b0519 (ahpF)
Enzymes [BR:paga01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PAGA_b0519 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_9 Thi4 FAD_binding_3 K_oxygenase Glutaredoxin NAD_binding_8 Lycopene_cycl FMO-like
Motif
Other DBs
NCBI-ProteinID: ATC84414
UniProt: A0A290RUH5
LinkDB All DBs
Position
II:438372..439955
Genome map
AA seq 527 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSAEVESLANDLASLSDKFTVVSNPDTSA
RRPSMVVHSPVKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKSEDIEQIESLNQELN
FEVYISLSCQTCPQVVQALNTMAATNSKIKATMIDGALFQDEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDTKGAAKQAAALSEKDEFDVLVVGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISVKATEGPKLVAQLEEHVKEYDVDVMHNQRAAGLGRGSNGY
EITLENGATLKAKSLVLATGARWREMNVPGEQEYRGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANSLSNITIIKNAQTTEVVGDGKK
VTGLNYTDRVTGEEKSLALAGIFVQIGLIPNTEWLKESDLTLSKFGEIEIDAKGATSLPG
VYGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSEQSDQDQNAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacattaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttattgccttggatgacagcaaaaaatcagcagaagtagaaagcttagca
aacgacttagcatcattaagcgacaaatttacggtagtgagcaaccctgataccagcgca
cgtcgcccgtctatggttgtacattcaccggttaaaaatacccacattacgtttgcaggc
gtacctatgggtcacgaatttacaagtttagtgttagcgcttttacacactggcggacac
gcaagtaaagcaaaaagcgaagacattgaacaaatagaatcactcaatcaagaacttaat
tttgaagtatacataagcttaagttgccaaacatgcccgcaagtagtgcaggcgctaaat
acaatggcagcaacaaacagcaaaattaaagcaacaatgattgacggcgcactctttcaa
gacgaagtagaagagcgcaatattttagcagtaccagctgtgtacttaaatggcgaacca
tttagccaaggtgcattaagcctgaccgacattttaaataaagtagacactaaaggcgct
gctaagcaagctgcagcactaagcgaaaaagacgagtttgatgtattagtagtcggtggc
ggacctgcgggtgcctcagccgctatttactctgctcgtaaagggttaaacaccggtata
gttgccgatagatttggtggtcaagttgccgatacgttggctattgaaaactttatttcg
gtaaaagccactgaaggtccaaagcttgttgctcagcttgaagagcatgttaaagaatac
gatgtagatgtaatgcataaccaacgcgcagcagggcttggtcgcggtagtaatggttat
gaaattacccttgaaaacggggctactttaaaagctaaatcgcttgttttagcaaccggt
gcacgctggcgtgaaatgaacgtacctggtgagcaagaatatcgcggccatggcgtagct
tactgcccacactgtgatggtccgctatttaagggtaagcctgttgccgttattggtggt
ggtaactcgggtatagaggcggctatcgacttagctaacattgtagagcatgtaactgtg
cttgagtttgctgacacgcttcgcgctgacgaagtacttattcgcaaagcaaatagctta
agcaacatcactattattaaaaatgcgcaaaccactgaagtagtaggcgatggtaaaaaa
gtaaccggacttaattacactgaccgtgtaacaggcgaggaaaaatcattagcacttgca
ggtatttttgtacaaataggtttgatccctaataccgaatggttaaaagagagcgacctt
acactaagcaagtttggcgagatagaaattgacgctaaaggcgcaacctcattaccgggc
gtttacggtgcgggtgacgcgacaaatacgccatttaagcaaatcattattgcaatgggt
agtggtgcaacagcaagcttaggggcgtttgattacttaattcgccatagcgagcaaagc
gaccaagaccaaaatgcagcttaa

DBGET integrated database retrieval system