KEGG   Pantoea agglomerans C410P1: BEE12_00450
Entry
BEE12_00450       CDS       T04739                                 

Definition
(GenBank) glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00521  Streptomycin biosynthesis
pagc00523  Polyketide sugar unit biosynthesis
pagc00525  Acarbose and validamycin biosynthesis
pagc00541  O-Antigen nucleotide sugar biosynthesis
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BEE12_00450
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BEE12_00450
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BEE12_00450
   00525 Acarbose and validamycin biosynthesis
    BEE12_00450
Enzymes [BR:pagc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     BEE12_00450
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: AOE38488
LinkDB
Position
complement(101208..102089)
AA seq 293 aa
MKKNKGIILAGGSGTRLYPVTMAVSKQLLPVYDKPMIYYPLSTLMLAGINDILIISTPQD
TPRFESLLGDGSQWGISIQYKVQPSPDGLAQAFIIGEEFIGDDSVALILGDNIFYGHDLY
KQLEAASLKDDGATVFAYHVTDPERYGVVEFDKEGKAISLVEKPENPRSNYAVTGLYFYD
NSVVEMAKNLQPSPRGELEITDINRIYMEQGKLSVSIMGRGHAWLDTGTHQSLMEANNFI
QTIESRQGLKVACPEEIAFRMGFIDKAQLQELAKPYLKNEYGKYLMALVEGRL
NT seq 882 nt   +upstreamnt  +downstreamnt
gtgaaaaagaataaaggtattattctcgctggcggctcaggaacgcgtctttacccggta
acaatggcagtcagtaagcaactgcttccagtttatgataagccgatgatttattatcca
ctcagcacgctgatgcttgcaggaattaacgatatcctgattatcagcacaccgcaggac
acgccgcgattcgaaagcctgctgggtgatggctctcagtggggcatctcgattcagtat
aaagtgcaaccgagtccggatggcctggctcaggcgttcatcattggtgaagagttcatc
ggtgatgattcagtcgcactaatcctcggcgataatattttctacgggcatgacctctac
aagcagcttgaagctgcgtcattgaaggatgatggcgctaccgtctttgcttatcacgtt
accgatcctgagcgttatggtgttgtagaatttgataaggagggtaaagctatttcgctg
gtggaaaaacctgagaaccctcgcagcaattatgccgttactgggctctatttttatgac
aacagtgttgtggaaatggcgaaaaacctgcagccttcccctcgtggtgaactcgagatt
actgacattaaccgtatctacatggagcaaggcaaactttctgtatccattatgggccgc
ggtcatgcctggcttgataccggtacgcatcagagtctgatggaagcgaacaactttatt
cagactatagaatcacgacagggcctgaaagtagcctgtccggaagagattgctttcaga
atgggttttattgataaagcgcaattacaggaacttgctaagccgtatcttaaaaacgaa
tatggcaaatatttgatggcgctggtggaagggcgtttataa

KEGG   Pantoea agglomerans C410P1: BEE12_07455
Entry
BEE12_07455       CDS       T04739                                 

Definition
(GenBank) glucose-1-phosphate thymidylyltransferase
  KO
K00973  glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00521  Streptomycin biosynthesis
pagc00523  Polyketide sugar unit biosynthesis
pagc00525  Acarbose and validamycin biosynthesis
pagc00541  O-Antigen nucleotide sugar biosynthesis
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BEE12_07455
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BEE12_07455
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BEE12_07455
   00525 Acarbose and validamycin biosynthesis
    BEE12_07455
Enzymes [BR:pagc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     BEE12_07455
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: AOE39708
UniProt: A0A6B3J1P6
LinkDB
Position
1656291..1657172
AA seq 293 aa
MKGIILAGGSGTRLHPITRAVSKQLLPVYDKPMIYYPLSVLMLAGIRDILLITTPEDRAQ
FERLLGDGSEFGIRLSYAVQPSPDGLAQAFIIGESFIGEDNCCLVLGDNLYFGQGFSPKL
RKVVEQNRGATVFGYQVMDPERFGVVEFDDNFRAISIEEKPQQPKSRWAVTGLYFYDNQV
IEFAKQVKPSARGELEITAINQMYLERGELTVELLGRGFAWLDTGTHDSLVEASMFVQTV
EKRQGFKIACLEEIAWRNSWLSDDQLRAAGEALTKTGYGQYLLDLLHARPRQY
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaaaggcatcattttagcgggagggtcgggcacgcggctacacccgataacccgtgca
gtatcaaagcaacttctgccggtttacgacaaaccgatgatctactatccgctctccgtg
ctgatgctggcgggtattcgcgacatcctgttaattaccacgccggaagaccgggcgcag
tttgaacgtctgctgggcgatggcagtgaatttgggatacgccttagctatgcggtgcag
ccaagtcccgatgggctggcgcaggcctttatcatcggcgaatcctttatcggggaggat
aattgctgcctggttctgggtgataacctctactttggccagggcttcagccccaagctc
cggaaagtcgtcgaacagaatcgtggcgcaacggtgttcggctatcaggtcatggacccg
gaacgtttcggcgtggtggagtttgacgataacttcagggcgatctcgattgaagagaag
ccacagcagccgaaatcgcgctgggcagtaaccgggctctatttttatgacaatcaggtt
attgaattcgcgaaacaggtgaagccctcagcgcggggcgagctggaaatcacggccatt
aaccagatgtatctggagcgtggtgagctgacggtcgaactgctgggacgaggttttgcc
tggctggataccggcacacacgacagcctggtggaagccagcatgtttgtgcagacggtg
gaaaaacgtcagggcttcaaaattgcctgcctggaagagattgcctggcgtaacagctgg
ctgagtgatgaccagctgcgggccgcgggtgaagcgctgacaaaaaccggctacggccaa
tacctgctggatttattacatgcccgtccacgtcaatattaa

DBGET integrated database retrieval system