KEGG   Pantoea agglomerans C410P1: BEE12_00460
Entry
BEE12_00460       CDS       T04739                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00521  Streptomycin biosynthesis
pagc00523  Polyketide sugar unit biosynthesis
pagc00525  Acarbose and validamycin biosynthesis
pagc00541  O-Antigen nucleotide sugar biosynthesis
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BEE12_00460
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BEE12_00460
   01055 Biosynthesis of vancomycin group antibiotics
    BEE12_00460
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BEE12_00460
   00525 Acarbose and validamycin biosynthesis
    BEE12_00460
Enzymes [BR:pagc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BEE12_00460
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short KR Sacchrp_dh_NADP Gp_dh_N NmrA NAD_binding_10
Other DBs
NCBI-ProteinID: AOE38490
LinkDB
Position
complement(103021..104100)
AA seq 359 aa
MKILITGGAGFIGSAVVRHVINNTNDEVINVDKLTYAGNLESLKEVSSNPRYTFKQIDIC
DGQAITKALNEFQPDAIMHLAAESHVDRSITGPAEFVQTNVVGTYALLEATRQYWSALPE
ERKAAFRFHHISTDEVYGDLPHPDEMEGDLPLFTEETPYAPSSPYSSTKAASDHLVRAWG
RTYKLPVIVTNCSNNYGPYHFPEKLIPLIISNALEGKPLPIYGKGDQIRDWLYVEDHARA
LYTVVKNAKTGTTYNIGGHNEKKNIDVVMKVCELLDQLRPKATPYSDQITYVQDRPGHDR
RYAIDAAKIEKDLGWKPEETFETGLKKTVEWYLNNSQWVEHVKSGAYQNWIEENYEKRS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaagattcttatcactggtggtgcaggttttatcggttcagcggttgtgcgtcatgtt
atcaacaatacgaacgatgaagtcattaacgttgataaactaacctatgcaggcaatctt
gagtctcttaaagaggtgagcagcaatccacgctatacctttaaacagatcgatatctgc
gacggtcaggctattactaaggctttaaatgagtttcaaccggatgccatcatgcatctt
gccgcagaaagccacgtagaccgctcgatcactggtccggctgagtttgttcagactaac
gtggtaggcacttacgctctgttagaagcaacccgtcaatactggagcgcgttacctgaa
gaacgtaaagcggcattccgttttcatcatatctcaacggatgaagtttatggtgactta
cctcatccggatgaaatggaaggcgatttaccgctgtttaccgaagagaccccttatgcc
ccgagcagtccatactcctcaacgaaagcagccagcgatcatctggttcgcgcctggggc
cgcacttacaagctaccggtgattgtcaccaactgctcgaacaactatggtccttatcat
ttcccggaaaaactgatcccactgatcattagtaatgcgctggaaggcaaaccactacct
atctacggtaaaggcgatcagattcgtgactggctttatgttgaagaccacgcgcgcgcg
ctttacaccgtagttaaaaatgcgaagactggcaccacctataacatcggcggacataac
gaaaagaaaaatatcgatgttgtgatgaaggtttgcgaactgctggatcagttgcgtcca
aaagcgactccgtacagtgatcaaattacctatgttcaggaccgcccgggacatgatcgt
cgctacgcgattgatgccgctaagattgaaaaggatttgggctggaaaccggaagagacg
tttgaaacgggcctgaagaaaaccgttgagtggtaccttaacaattcacagtgggttgag
catgtgaagagtggtgcgtaccagaactggatcgaagaaaattacgagaaacgtagctaa

KEGG   Pantoea agglomerans C410P1: BEE12_07450
Entry
BEE12_07450       CDS       T04739                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00521  Streptomycin biosynthesis
pagc00523  Polyketide sugar unit biosynthesis
pagc00525  Acarbose and validamycin biosynthesis
pagc00541  O-Antigen nucleotide sugar biosynthesis
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BEE12_07450
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BEE12_07450
   01055 Biosynthesis of vancomycin group antibiotics
    BEE12_07450
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BEE12_07450
   00525 Acarbose and validamycin biosynthesis
    BEE12_07450
Enzymes [BR:pagc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BEE12_07450
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 Sacchrp_dh_NADP adh_short KR
Other DBs
NCBI-ProteinID: AOE39707
LinkDB
Position
1655201..1656271
AA seq 356 aa
MRRFLITGGAGFIGSALVRFLIAETEHQVVVVDKLSYAGNLASLASVADSSRFHFEQVDI
CDRPALDQVFARHQPDCVMHLAAESHVDRSIDGPLAFIETNIVGTYQLLEAARFYWQNLD
DARKTAFLFHHISTDEVFGDLHDSQAYFTETTPYAPSSPYAASKASSDHLVRAWLRTYGL
PTLVTNCSNNYGPCHFPEKLIPLTIINALAGKALPVYGNGQQIRDWLYVEDHARALYQVV
SHGKPGETYNIGGHNERRNIEVVETICSLLEELAAEQKPAGLAHYRDLITYVTDRPGHDQ
RYAIDASKIAHELGWVPQETFESGMRKTVAWYLTNPTWWQAILDGRYQGERLGLSQ
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaggcgttttctgatcacgggcggtgccggttttatcggttctgcactggtgcgcttt
ctgatcgcagaaaccgaacatcaggtggtggtggtcgataaactcagctacgccggaaat
ctggcgtcactcgccagcgttgccgactcgtcccgctttcattttgagcaggtcgatatc
tgcgatcgcccggcacttgatcaggtgtttgcccgtcatcagccagactgtgtgatgcat
cttgcggctgaaagccatgtggatcgttcaattgacgggccgttggcctttatcgagacc
aatattgtcgggacttatcagttgctggaagccgcgcgtttctactggcaaaacctggat
gacgcgcgcaaaaccgcctttctgttccaccatatctcgaccgatgaagtctttggcgat
ctgcatgacagccaggcttacttcaccgaaaccacaccttatgcgccaagcagtccttac
gccgccagcaaggccagcagcgaccatttagtgcgggcctggctgcgaacttacggtctg
cccacgctggtcaccaactgttcaaataactacggcccctgccatttcccggagaagctg
atcccgctgaccatcatcaatgcgctggccgggaaagccttgccggtttacggcaacgga
cagcagattcgtgactggctctacgtcgaagatcacgcccgcgcactctatcaggtggtc
agccatggcaagccaggcgaaacttataatattggcggccataacgagcgacgcaatatt
gaggtggtcgaaactatctgcagcctgcttgaagagctggccgcagagcagaaacctgcc
gggctggcgcattaccgcgacctgattacctatgtcactgaccgccccggtcacgatcag
cgctatgccattgatgccagtaaaatcgcgcatgaacttggctgggtgccgcaggaaacc
tttgaaagcggcatgcgtaaaaccgtggcatggtatctgaccaatcccacttggtggcag
gctattctggatggccgctatcagggcgaacgccttggcttatcgcaataa

DBGET integrated database retrieval system