KEGG   Pantoea agglomerans C410P1: BEE12_05305Help
Entry
BEE12_05305       CDS       T04739                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00564  Glycerophospholipid metabolism
pagc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BEE12_05305
Enzymes [BR:pagc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BEE12_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AOE39324
LinkDB All DBs
Position
1173609..1175114
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHLAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KSLRFGADSALKPEITRGFEYSDCWVDDARMVVLNAQEVVKRGGEVRTRTRVTRAWREGG
LWKVEAEDVDSGKTFTWQAKGLVNAAGPWVKQLFDDSLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVNIDDSETDYLLKVFNGHF
KKQLTAEDIVWSYSGVRPLCDDESDSPQAITRDYTLDVRDDNGQAPLLSVFGGKLTTYRK
LAEHALEKLAKYYPNAGPAWTKNCVLPGGNISGTREDYAASLRRRYPFISENMARHFSRT
YGSSTETLLAGAKSLDDLGENFGHEFYEAELRYLVQHEWVRELDDAIWRRTKQGMWLTKE
QQARVTEWLAAKAKPALSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtgatcggcggcggcatcaacggtgccggcattgcagca
gacgctgcaggacgcggactgtcggtgttaatgctggaggcgcgggatctggcttgcgcg
acctcctctgccagttcaaaactgattcacggcggcttgcgctaccttgaacattacgaa
ttccgtctggtcagtgaagcactggccgagcgtgaagtgctgctgaaaatggctccgcat
ctggcgttcccgatgcgcttccgtctgccgcaccgtccgcatctgcgtccggcgtggatg
atccgcaccggcctgtttatgtatgaccatcttggcaagcgtaccagtctgccaggcagc
aaaagtttgcgatttggcgcggattcggccctgaagccggaaattacgcgcggattcgaa
tattctgactgctgggtcgatgatgcccgcatggtggtactgaacgcacaggaagtcgtg
aagcgtggcggcgaagtgcgtacccgcacccgcgtgacccgtgcctggcgtgaaggcggc
ctgtggaaggtcgaagcggaagatgtcgacagcggtaaaacctttacctggcaggcgaaa
ggcctggtcaatgctgccggcccgtgggttaaacagctgttcgacgacagcctgaagctg
aaatcgccttacggtattcgcctgatcaagggcagccacatcgtggtgccacgcgtccat
accgaaaagcaggcttacatcctgcagaacgaagataaccgcatcgtgtttgtcatcccg
tggatggatgagttctctatcatcggtaccaccgacgtggagtacaaaggcgatccgaaa
aacgtcaatattgatgacagcgagaccgactatctgctgaaagtgttcaacggacacttt
aaaaagcagctgaccgctgaggatatcgtctggtcctattccggcgtccgtccgctgtgt
gatgacgaatccgattcgccgcaggcgatcacgcgtgattacaccctggatgtgcgcgac
gataatggtcaggctccgctgctgtcggtgtttggcggcaagctgaccacctaccgtaag
ctggcagaacatgcgctggagaaactggcgaagtactacccgaacgcgggcccggcatgg
acgaagaactgcgtgttgccaggcggaaatatctccggcacccgtgaagattatgcggcc
agcctgcgtcgtcgctatccgtttatcagtgaaaatatggcgcgccacttctcgcgcacc
tacggcagcagtactgaaaccctgctggctggcgcgaaaagcctggacgatctgggtgag
aacttcggtcacgagttttacgaagcagagttacgctacctggtgcagcatgagtgggtt
cgtgagctggatgatgctatctggcgtcgtaccaaacagggcatgtggctgaccaaagag
cagcaggcgcgagttaccgaatggctggcagcgaaagccaaacccgcactgtcactggct
tcataa

DBGET integrated database retrieval system