KEGG   Pantoea agglomerans C410P1: BEE12_06275Help
Entry
BEE12_06275       CDS       T04739                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00010  Glycolysis / Gluconeogenesis
pagc00030  Pentose phosphate pathway
pagc00051  Fructose and mannose metabolism
pagc00052  Galactose metabolism
pagc00680  Methane metabolism
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
pagc01120  Microbial metabolism in diverse environments
pagc01130  Biosynthesis of antibiotics
pagc01200  Carbon metabolism
pagc01230  Biosynthesis of amino acids
pagc03018  RNA degradation
Module
pagc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEE12_06275
   00030 Pentose phosphate pathway
    BEE12_06275
   00051 Fructose and mannose metabolism
    BEE12_06275
   00052 Galactose metabolism
    BEE12_06275
  09102 Energy metabolism
   00680 Methane metabolism
    BEE12_06275
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BEE12_06275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pagc01009]
    BEE12_06275
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pagc03019]
    BEE12_06275
Enzymes [BR:pagc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BEE12_06275
Protein phosphatases and associated proteins [BR:pagc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BEE12_06275
Messenger RNA biogenesis [BR:pagc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BEE12_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AOE39497
UniProt: A0A2A7V7M3
LinkDB All DBs
Position
complement(1391092..1392054)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALSEGLEVFGIYDGYLGLYEDRMINLDRYSVSD
MINRGGTFLGSARFPEFRNEDVRQVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEFPYTREELVAEIKAGIAKGKKHAIVAITEHICDIDDLARFIETETK
RETRSTVLGHIQRGGAPCAYDRILASRMGAYSIELLMQGYGGRCVGIQNEKMVHHDIVDA
IENMKRPFKRDWLDTAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtattaaccagcggcggtgacgccccaggcatgaacgcagct
attcgtggcgtggtgcgttccgcgctgagtgaaggactggaagtttttgggatctatgac
ggttacctgggattgtacgaagatcgcatgatcaatcttgatcgctacagcgtttccgac
atgattaaccgcggcggcactttcctgggctcagctcgcttccctgaattccgtaatgaa
gatgtgcgtcaggttgctattgagaacatgaaaaagcgcggcattgatgcgctggttgtt
attggtggtgacggttcctacatgggggctaagcgcctgactgaaatgggcttcccgtgc
attggtctgccaggcaccatcgataacgacgttgccggaacggattacactatcggttat
ttcactgcgctggaaaccgtggttgaagcgattgaccgcctgcgtgatacctcttcatcg
catcagcgtatttcgattgtggaagtgatgggtcgctactgtggcgatctgacactggcg
gccgccattgcgggtggctgtgagttcatcgtactgcctgagttcccgtatacccgtgaa
gagctggtagcggaaatcaaagcgggcatcgccaaaggtaaaaagcacgctatcgtggcg
attaccgagcacatctgcgatatcgacgatctggcgcgtttcatcgaaacagaaaccaag
cgtgaaacccgttctaccgttctgggccacattcagcgtggcggtgcaccttgtgcgtat
gaccgtattctggcttcacgcatgggtgcctactccattgaactgctgatgcagggttac
ggcggccgttgcgtcggtattcagaacgagaagatggtgcatcacgacatcgtcgacgcc
attgagaatatgaagcgtccgttcaaacgcgactggctcgacaccgcaaaaaaactctat
taa

DBGET integrated database retrieval system