KEGG   Pantoea agglomerans C410P1: BEE12_08810
Entry
BEE12_08810       CDS       T04739                                 

Definition
(GenBank) conjugal transfer protein TraG
Organism
pagc  Pantoea agglomerans C410P1
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: AOE39946
LinkDB
Position
1947309..1948847
AA seq 512 aa
MTANSYLEYFLILFGWVLNNSMWGILSSTGLFALPLVFKVLGVWLKVREEGADEGNKGML
ALPRIEHAIYVSFLVMLFCCIPLLPVDISTIKFDDARAKQCGFSVPTPQNSGYKGLVNDF
DGRTAEVPVWWYLLHAMSKGTTQAMIASIPCGTQLRQLRFDVQNTKLRDPVVLQEVQDFA
NQCYSRAYFKLKNSNSQLSDATINSVGWIGSDYFLNTSGYYDYYTAMTPRSQWPYSSSRD
SGYPDTGQGGYPTCKTWWSDGSSGLRKRVLASISDGTRIELQRQFPGRQWEEPALRWLVS
PRNAGLSGDGTTYAISSADNNSGVVGNLTRLTSTIGLGLKQAEALPGFDALKQALPMIQA
LLQMMIIIVIPALMMFSAYEPKTVVTISFALFALQFITFWWALAGWLDDRLITILYNNMA
DQGLTSSVPFANFMSSTNDGWIMNLVLGMMYLVFPTFWIGMLSWIGVNLGSIVQSGLERA
GSPAQDAGAKAGRDAQGFVTSSIQGGIKGGPK
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgacggcgaacagttacctggaatacttcctcatcctgtttggctgggttctcaataat
tcgatgtggggcatcctcagcagcaccgggctgtttgcactgccgctggtttttaaggta
cttggcgtatggctgaaggtgcgcgaggaaggtgccgatgagggaaacaaaggtatgctt
gcgctgccgcgcatcgagcacgcgatttacgtatcctttctggtgatgctgttctgctgc
attccgctgttgccggtggacatcagcaccataaagttcgatgacgctcgggcgaaacag
tgcggcttcagcgtacccacgccgcagaactccggctataaagggctcgttaacgacttc
gacggtcgtacggccgaggtgccagtatggtggtatctgctccatgcgatgtcaaaaggc
accacgcaggctatgatagcgtcaatcccctgcggcacgcagttgcgtcagcttcgcttt
gacgtgcagaacaccaagctgcgcgacccggtagtgctgcaggaggtccaggacttcgca
aaccagtgctactccagggcctactttaagttaaagaacagcaacagccagctgagcgac
gctaccatcaactcggtcggatggattggcagcgactattttctcaacacatcaggctat
tacgactattacacggccatgacgccccgcagtcagtggccatacagcagcagtcgtgac
agcggttatccggatacgggccagggtgggtatccgacgtgcaaaacctggtggtcagac
ggcagcagcggactgcgcaagcgtgtactggccagcatcagcgacggcacacgcattgag
ctgcagcgtcagttcccgggcagacagtgggaagagccggcgctgcgctggctggtcagc
ccacgcaatgctgggctgtccggtgacggcacaacttacgccataagcagcgcagataat
aacagcggcgttgtcggtaacctcacccggctgacctcgacaattgggctgggtctgaag
caggccgaagcactgccgggatttgatgcgctcaagcaggcgctgccgatgatacaggcg
ctgctgcagatgatgatcattattgttatccccgcgctgatgatgttcagtgcctatgaa
cccaaaacagttgtgacgatttcttttgcgctgtttgctttgcagttcatcacgttctgg
tgggcgctggcgggatggcttgatgatcgccttattaccattctctacaacaatatggct
gaccagggactcaccagttccgtgccttttgccaatttcatgagctcaaccaacgatggc
tggatcatgaacctggtgctgggaatgatgtacctagtgtttcctacgttctggataggc
atgcttagttggattggtgtcaacttaggaagcatagtccagtcgggcctcgaaagggca
ggttctccggctcaggatgcaggagctaaagcgggacgagatgctcagggctttgttaca
agtagcattcagggtggtataaaggggggacccaagtaa

DBGET integrated database retrieval system