KEGG   Pantoea agglomerans C410P1: BEE12_15570Help
Entry
BEE12_15570       CDS       T04739                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pagc  Pantoea agglomerans C410P1
Brite
Enzymes [BR:pagc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BEE12_15570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu SEF14_adhesin
Motif
Other DBs
NCBI-ProteinID: AOE41140
LinkDB All DBs
Position
3405438..3405956
Genome map
AA seq 172 aa AA seqDB search
MKMKAVALFALIACGSAQAASEQVTIHQVTAEGIGKSLGTVKIDETQYGLQFTPDLQGLQ
PGIHGFHVHAKGSCEPGESEGKVVAAGAAGGHLDPANSGKHLGPYAEGHLGDLPAVYVDD
KGSATYPVLAPRLKSLKEIKGKALMVHVGGDNHADHPKPLGGGGARYACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaagcagttgccttattcgcactgatcgcctgcggctcagcacaggctgcc
agcgagcaggttacgatccatcaggttaccgctgaagggattggaaaatcgctgggcacc
gttaagattgacgagacacagtatggtctgcagttcacgccggatctgcaggggcttcag
ccaggcattcatggtttccatgtccatgccaaaggcagctgtgagccgggcgagtctgag
ggcaaagtggtcgccgccggtgcggcgggtggccaccttgatccggccaacagcggcaaa
catctggggccttatgcagaggggcacctgggcgacctgcccgcagtctatgtcgatgac
aaaggcagcgccacttatccggtgctggcaccgcgtctgaaatcgttaaaagagatcaaa
ggcaaagcgctgatggtgcacgtcggcggtgacaatcatgccgaccatcctaaaccgctg
ggcggtggcggggcacgctacgcctgcggtgtcatctga

DBGET integrated database retrieval system