KEGG   Pantoea agglomerans C410P1: BEE12_20550
Entry
BEE12_20550       CDS       T04739                                 

Definition
(GenBank) alcaligin biosynthesis protein
  KO
K03897  lysine N6-hydroxylase [EC:1.14.13.59]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00997  Biosynthesis of various secondary metabolites - part 3
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
pagc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BEE12_20550
Enzymes [BR:pagc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.59  L-lysine N6-monooxygenase (NADPH)
     BEE12_20550
SSDB
Motif
Pfam: K_oxygenase Pyr_redox_2 Pyr_redox_3
Other DBs
NCBI-ProteinID: AOE42223
LinkDB
Position
unnamed1:277523..278815
AA seq 430 aa
MNNSVYDFIGIGIGPFNLSLACLSEPVEGLNGLFLDENPGFDWHTGMMLENAHLQTPFMA
DLVTLADPTSPYSLLNYMKEKGKLYSFYIREDFFLMRKEYNQYCQWASSRLSNLRWNSHV
EYVSYDETAGVYQLQVTDTRNGQKQNYLARHLILGTGPKAWMPECSQPHRQRLTHSSHYL
VNKAELQQKRSITVLGSGQSAAEIYYDLLTDIDRFGYQLNWITRAPRFYPLEYTKLTLEM
TSPEWVDYFHALPASTRDELNARHKNLYKGINSSLINDIYDLMYVKQLDGDLNVNLFTHS
ALTAMRWLPQGEFELTLHQEEQDCTFTRRTEGLVMATGYHYQPPMFLEGINPRLRWDDKG
RYDVQRNYSIDYHNQIFVQNAELHTHGFVTPDLGMACYRNSVLLRELTGREVYPIERQIA
FQTFPAKSEH
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaataattccgtttacgattttattggtatcggtatcggtccttttaacctgagcctg
gcctgtctgagtgagccggttgaggggctgaacggtcttttcctggatgagaacccgggc
tttgactggcacaccggcatgatgctggaaaatgcccatctgcagacgccgtttatggcc
gatctggtgacgctcgccgatccgaccagcccttacagcctgcttaactacatgaaggaa
aaggggaaattatactctttttatatccgcgaagacttcttcctgatgcgcaaagagtat
aatcagtactgccagtgggccagttcacggctctctaatctgcgctggaacagccacgtt
gagtatgtcagctacgatgagacggctggcgtctatcaactccaggtgaccgacacccga
aatggccagaaacagaactatctggcacgacatctgatccttggcaccgggcctaaagcc
tggatgccggagtgcagccagccgcaccgccagcgccttacgcactcaagccactatctg
gtcaacaaagccgaactgcagcagaagcgttccatcaccgtgctgggcagcggccagagc
gcggcagaaatctactacgacctgctgaccgatatcgaccgctttggctatcagctcaac
tggatcacccgcgcgccgcgcttctatccgctggagtacaccaagctcacgctggagatg
acctcgccggaatgggtcgactatttccacgccctgcccgccagcacccgtgacgaactg
aatgcgcgccacaagaatctctacaaaggcatcaacagcagcctgattaacgatatttat
gacctgatgtatgtcaaacagctcgacggcgatctgaacgttaacctgtttactcactcg
gcgctgaccgctatgcgctggctgccgcagggagagtttgagctgacgctgcatcaggag
gagcaggattgcaccttcacccgtcgcaccgaaggactggtgatggcgaccggctatcac
taccagccaccgatgtttttagagggcatcaacccccgcctgcgctgggatgacaaaggc
cgctacgacgtgcagcgcaactacagcattgattatcacaatcagatctttgtgcagaac
gccgaactgcacacccacggctttgttacgccggatctcggcatggcctgctaccgcaac
tcggtgctgctgcgcgaactgaccggacgcgaggtctacccgatcgagcgtcagattgcc
ttccagaccttcccggctaaatcggagcactga

DBGET integrated database retrieval system