KEGG   Pantoea agglomerans C410P1: BEE12_22715
Entry
BEE12_22715       CDS       T04739                                 

Definition
(GenBank) CoF synthetase
  KO
K22113  fumarate---(S)-2,3-diaminopropanoate ligase [EC:6.3.2.46]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00997  Biosynthesis of various secondary metabolites - part 3
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BEE12_22715
Enzymes [BR:pagc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.46  fumarate---(S)-2,3-diaminopropanoate ligase
     BEE12_22715
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: AOE42605
LinkDB
Position
unnamed2:174999..176171
AA seq 390 aa
MNLEMWVQNISATFPWYAQLLRDKQADLSRLESLPLITEELLTQHYYHAENCFAGEHHSY
LTSGTTSGKRKRIFYSDNDQRIYLQQRMGIIRDFCGEGHTRACADLGTGHAAATAGEIFQ
AMGCDVELIDFTRPIEQHIEVLNRFKPDIFFTMPMILDSLIATGKLDFQPKRIILLGDVA
SLNWQNKVADYFHIKPAQVLDLFGSIEIGSIAFYNHAQKRYQFDSYVRPEVVPVQSLYPG
AKYGGDGGILLLTSFAREYFPAVRFVTNDLIEGFAHENVGGRTVYTYQRCLGRFAGEFKH
GEKINLSDISDALANNLPYHKYDLADHEGGLVIRIAAKSIPTEVIEAIKHDLLARNPDIA
QMISSGLVGDIRIQCVDAQEITGNVSKRRY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaatctggaaatgtgggtacaaaacattagcgccacattcccctggtatgcgcaatta
ctcagggataagcaggcagatctcagccgcctggagtcgctcccgcttattacagaagaa
ctgctgacgcagcattactaccatgcggaaaattgctttgccggcgagcatcacagttat
ctgacatctggtaccacatcgggcaagcgtaagcgtatcttttattccgataatgatcag
cgtatttatttacaacaacgcatgggcatcatcagagatttttgcggagaaggacatacc
cgcgcctgtgctgatctgggtaccggtcatgcggccgcaacagccggagaaatttttcag
gcaatggggtgtgatgtcgaattgatcgatttcactaggccgattgagcaacatatcgag
gtacttaaccgcttcaagcctgacattttttttacaatgccgatgatacttgattctctt
atagcaactggaaaactcgattttcagccaaagaggatcatcttgttaggcgacgtggca
agtttgaactggcaaaataaagtagcggactacttccatattaaaccggcgcaggtatta
gatctctttggtagcattgaaatcggttctatcgccttctataaccatgcacaaaagcgt
taccagtttgattcttatgtccgaccagaagttgtgccagtacaaagtctatatcctggt
gcgaaatatggtggtgacggcggtattctactgctcacttcgttcgcccgtgaatacttc
ccggcagtacgttttgtgactaacgatttaattgaaggattcgcacatgaaaacgttgga
ggacgaaccgtttacacctatcagcgttgcttaggccgctttgccggtgaatttaaacac
ggtgaaaaaattaacctcagcgatattagtgatgctttggcaaataatctgccttatcac
aaatatgatctcgccgatcatgaaggcggcttggtaattcgcatagcggcgaaatcgatt
ccgacggaagtcattgaagctatcaagcatgatctgttggcccgaaaccccgatatagct
caaatgatttcttccggattggtcggtgatattcgtattcagtgtgttgacgcacaggaa
atcaccggcaacgtcagtaaacgccgctattaa

DBGET integrated database retrieval system