KEGG   Pantoea agglomerans C410P1: BEE12_22720
Entry
BEE12_22720       CDS       T04739                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01957  N-3-fumaroyl-(S)-2,3-diaminopropanoate amidotransferase [EC:6.3.5.-]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00997  Biosynthesis of various secondary metabolites - part 3
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BEE12_22720
Enzymes [BR:pagc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.-  
     BEE12_22720
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC DUF3700 DUF5891
Other DBs
NCBI-ProteinID: AOE42606
LinkDB
Position
unnamed2:176194..178017
AA seq 607 aa
MCGIAGVINYHRQPTQPSLLASMLASLKHRGPDQEGVYHQGHVGIGMRRLKIIALDNGAQ
PCYSNDGRYVLVFNGEIYNYRLLRAELIAQGFRFETESDAEVIVNLYQRDGEAFYQRLDG
MFALAIYDRIDDTLLLARDPAGKKPLFYALHDGVVSFSSELNSLLKDERIPRHIDPVALD
YYLRFRVVPGDHCIFQNISKVAAGGGVSFALGKESRQHYWRVAYQPEPDEKPLEQWVDEI
DEYLNQAISKRLMAEVPIGTMLSGGLDSSLITAIACKQSRHKLKTFAVGFNESAFSELEY
SRRLAKDLGTEHHDFIITPGEAFDAAHDLVKHFGEPFAFPSSIASHFMYRLARQHVAVVL
GGDGADELFGGYARYSLVANFPHLPAEHKLPRKVDLLNKAWRADEFPEFYHALLTDGVGG
QLRQQLYSRSMALRLAEEGSVAQVRSYRDELTMHSDPLSAAMEYDFNHWMQEAQMVKVDI
ASMANSLEVRAPFLDRQIVGFGSRLPGQLKLHAGKEKYLLQCLAKRYLPDYIVDRKKQEL
AVPLEQWMVSSMKTLIIDTLTSEQALSRGYFNPDKLRQFVREFDGSHSYALWTMYMLEKW
HQQFFDN
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtgtggtattgcaggggtcatcaactatcatcgccagccgacgcagccttcactgtta
gcgtcaatgttagcttctctgaagcaccgtggtccagatcaagaaggtgtatatcatcaa
gggcatgtcggcataggcatgcggcgtttaaaaataatcgcactggataatggcgcacag
ccctgttacagcaatgacgggcgatatgtactggtatttaacggtgaaatctacaattac
cggcttttacgtgctgagttgatagctcagggatttagatttgaaactgaatccgatgcg
gaagtaatcgttaacctctatcaacgggacggtgaagccttctatcagcgactggatggc
atgttcgctctagccatttacgacagaatcgacgatacactgctactggctcgcgacccg
gcaggtaagaagccgctgttttatgcacttcacgatggtgttgtcagcttctcttctgaa
ctgaactccttactaaaagatgaacgtattccacgccacatagatcctgtggcgctggat
tattatctgcgctttcgtgtggtgccgggcgatcactgtattttccaaaacattagtaaa
gtggcagccggtggaggtgtcagcttcgcgctaggaaaggaaagccgacagcattattgg
cgcgtggcttaccagccagagccggatgaaaagccgctggaacagtgggttgacgagatt
gatgagtatttgaaccaggctatctctaaacgtctgatggcggaggtgccaatcggcacc
atgcttagcggcgggcttgattcaagcctgattactgccatcgcctgcaagcagagccga
cataagctgaaaaccttcgctgtgggcttcaatgaatccgcgtttagcgaactggagtac
tcccgaaggctggccaaggatctgggtacagagcatcatgatttcatcattacaccgggc
gaggctttcgacgcagcacatgatctggtcaagcactttggtgagccttttgcatttcct
tcttcgatagccagtcactttatgtatcgtctggcacgtcagcacgtggcggtagtactc
ggcggtgatggggcagatgaattatttggtgggtatgcccgttactcgttggtagcaaat
tttccccatttacccgctgagcataaactgcctcgcaaagttgacctgttaaacaaggcg
tggcgtgcagatgaattccctgaattttatcacgcgcttttaaccgatggcgtaggaggt
caattacgccaacaactctatagcagatcaatggcgctacggttagccgaagagggtagc
gttgcacaggtaagaagctatcgcgatgaactaacgatgcactcagaccctctttctgct
gccatggaatatgatttcaatcactggatgcaggaagctcagatggtcaaggtggacatc
gcatcaatggctaattcgcttgaggtacgcgcaccttttctggacaggcagattgttggt
tttggaagtcgtttgccgggacagctcaaactccatgccgggaaggagaaatacctcctg
cagtgtctggcgaagcgctacctgccagactatattgttgaccgcaaaaaacaggaactt
gccgttcctctggagcaatggatggtgtcgtcgatgaaaaccctcatcatcgatactctg
accagcgagcaggcattatctcgcggctattttaatcctgacaaattacggcaattcgtc
agggaattcgacggtagccatagttatgcactgtggacaatgtatatgctggaaaaatgg
caccagcagttttttgacaattag

DBGET integrated database retrieval system