KEGG   Pantoea vagans FDAARGOS_160: AL522_01925Help
Entry
AL522_01925       CDS       T04302                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00010  Glycolysis / Gluconeogenesis
pagg00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pagg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL522_01925
   00500 Starch and sucrose metabolism
    AL522_01925
Enzymes [BR:pagg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     AL522_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Motif
Other DBs
NCBI-ProteinID: AMG56465
UniProt: A0A109Y9Q1
LinkDB All DBs
Position
unnamed2:308151..309545
Genome map
AA seq 464 aa AA seqDB search
MKTFPDSFLWGGAVAANQVEGAWREEGKGLSTSDVQPQGIFGPVVERVAGSQSLKDVAID
FYHRYPDDIRLFAEMGFGCLRVSIAWTRIFPNGDEQQPNEAGLAFYDRLFDELAAHNITP
LVTLSHYEMPWNLVKQYGGWGNRQVIGFFEHYARTVFNRYQKKVSLWLTFNEINMSLHAP
MTGVGLPETSSLGEIYQAIHHQLVASALAVKACHEINPDASIGNMLLGGLVYPLSCKPDD
VLEALQENRKWQFFGDVQCRGAYPGYMLRFFRDNNILLDITDADRQILKSTVDFISFSYY
MSGCVTADEALNEKMRGNILSMVPNPHLQSSEWGWQIDPVGLRTLLNLLWDRYQKPLFIV
ENGLGAKDIPDATGVVQDDYRISYLNDHLVQVREAIEDGVEVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDNGEGSLARSRKKSFHWYKEVIATNGASLKE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccggattcatttttatggggcggtgctgttgccgctaaccaggttgaa
ggcgcatggcgtgaagagggcaaaggcctttccacctctgacgtccagccacaggggatt
tttggcccggtcgtggagcgcgttgcggggagccagagccttaaagatgtggcgatcgat
ttttaccaccgctacccggacgatatcaggctgtttgcagagatgggcttcggctgtctg
cgggtttcaattgcctggacgcgtattttcccgaacggtgacgagcagcaacccaacgag
gctggcctggccttttatgaccgcttattcgatgagctggcagcgcataacatcactccg
ctcgtgaccctgtcacattatgaaatgccctggaatctggttaagcagtatggtggctgg
ggcaaccgtcaggtaatcggattctttgaacattacgcacgcacggtgtttaaccgttat
cagaagaaagtcagcctctggctgacatttaacgaaattaacatgtctctgcatgcgccg
atgaccggcgtgggtctgccggaaaccagcagcctgggcgaaatttatcaggcgattcac
catcaactggtcgccagtgcgctggcggttaaagcctgtcacgagatcaacccggatgcc
agcatcggcaatatgctgctgggtggtttggtctacccgctaagctgtaaacccgacgat
gtgctggaagcgctgcaggagaaccggaaatggcaattttttggcgatgtgcagtgccgg
ggagcttatccgggctatatgttgcgcttcttccgcgacaacaacattctgctggatatt
acggatgccgatcgccagatactcaaatcgaccgtcgattttatctcgttcagctactac
atgtccggctgtgttaccgccgatgaggcgctgaatgagaagatgcgcggtaacattctg
agcatggtgcctaatccccatcttcagagctcagaatggggctggcagattgatccggtc
gggttgcgtaccttgcttaatctgttgtgggatcgttatcaaaagccgctgttcatcgtt
gagaacggactgggtgccaaagacattcctgatgccaccggcgtcgtgcaggatgactac
cgcatcagctacctcaacgatcatctggtgcaggtgcgtgaagcgattgaagatggtgtt
gaggtcatggggtataccagctgggggccgatcgatcttgtgagcgcatctaaagcggaa
ctgtctaaacgctacggttttatttatgtagaccgcgatgacaacggggaaggttcgctg
gcgcgcagccgtaagaaaagcttccactggtataaagaggttattgcgacaaacggggcc
tcactcaaagagtaa

DBGET integrated database retrieval system