Pantoea vagans FDAARGOS_160: AL522_11710 Help Entry AL522_11710       CDS       T04302                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pagg  Pantoea vagans FDAARGOS_160 Pathway pagg02020   Two-component system pagg02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pagg00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AL522_11710  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     AL522_11710  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pagg02035]     AL522_11710 Bacterial motility proteins [BR:pagg02035]  Flagellar system   Flagellar assembly proteins    Others     AL522_11710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF6285 PMI_typeI_hel Motif Other DBs NCBI-ProteinID:  AMG58244 LinkDB All DBs Position complement(1744178..1744483) Genome browser AA seq 101 aa AA seqDB search MSIDRTQPLKPASTVQSRDSSESGSSKVRQSASPVAATTPAAAQVSLSSAQSQLMQPSSK DINVERVEQLKTAIRNGELKMDTGKIADALIADTKAYLEGN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcattgacagaacgcaacctctgaaacccgccagcaccgtccagagccgcgacagc agtgagtctggcagcagcaaagtgcgtcagagtgccagcccggtagcagccacgacccca gctgcagcccaggtcagcctgagcagtgcgcagtcgcagctgatgcagccgagcagcaaa gatattaacgtcgagcgcgttgaacaactgaaaaccgccattcgtaatggcgaactgaag atggataccggcaaaatcgccgatgcgctgattgccgacactaaggcgtatttagagggt aattaa

DBGET integrated database retrieval system