KEGG   Pantoea vagans FDAARGOS_160: AL522_12245Help
Entry
AL522_12245       CDS       T04302                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00030  Pentose phosphate pathway
pagg01100  Metabolic pathways
pagg01110  Biosynthesis of secondary metabolites
pagg01120  Microbial metabolism in diverse environments
pagg01130  Biosynthesis of antibiotics
pagg01200  Carbon metabolism
pagg01230  Biosynthesis of amino acids
Module
pagg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagg_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AL522_12245
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AL522_12245
Enzymes [BR:pagg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AL522_12245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AMG58341
LinkDB All DBs
Position
1841538..1842368
Genome map
AA seq 276 aa AA seqDB search
MNPFNLPVEDLERRARAIRRRIIQLNAGSPAGGHTGADLSQVEILTALYFRILNCAPDRT
DDDQRDIYIQSKGHAVSGYYCVLAEAGYFPTNWLATYQHADSHLPGHPVRQKTPGVELNT
GALGHGLPVAVGIAIAAKKDNSSRRIFVVTGDGELAEGSNWEAALVAAHYGLDNLIIIND
KNKLQLAGATRDIMNTEPLPEKWRAFGLEVTECNGNEMAAVVDTIENLPKNGKPQVIVAH
TEKGFGISLIQSKAEWHHRVPKGEEIALALEELKDE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttcaatcttcctgtcgaagaccttgagcgtcgggcgcgtgctatccgccgt
cgcatcatccagctaaatgcgggcagcccggcaggcggtcataccggtgccgatctgtcg
caggtggagatcctcaccgcgctttacttccgcattctgaactgcgcccctgatcgcact
gacgacgatcagcgtgacatctacatccagtccaaaggccatgcggtgagcggttattac
tgcgtgctggcggaagcgggctactttccaaccaactggctggcaacctatcagcatgcc
gactcacatctgcccggccatccggtgcggcagaaaacgcctggcgttgagctgaatacc
ggcgcactgggacacggtctgccggtggcggtgggcatcgctatcgcagcgaaaaaagat
aacagctcgcgccgcatctttgtggtgaccggcgacggggaactggccgaaggcagcaac
tgggaggcggcactcgtcgcggcgcattacggcctcgataacctgatcatcattaatgac
aaaaacaagctgcaattggcgggcgcgacccgcgacattatgaacaccgaaccgctgccg
gaaaaatggcgtgccttcgggctggaggttaccgaatgcaacggcaatgagatggcggcg
gtcgtcgacaccattgaaaacctgccgaagaacggcaagccgcaggtgatcgtggcacat
accgaaaagggatttggtatctccttaattcagagcaaagccgaatggcatcaccgggtg
ccgaaaggcgaagagatcgcgctggcactggaggaactgaaagatgagtaa

DBGET integrated database retrieval system