KEGG   Pantoea vagans FDAARGOS_160: AL522_22250Help
Entry
AL522_22250       CDS       T04302                                 

Gene name
iolE
Definition
(GenBank) myo-inosose-2 dehydratase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00562  Inositol phosphate metabolism
pagg01100  Metabolic pathways
pagg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AL522_22250 (iolE)
Enzymes [BR:pagg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     AL522_22250 (iolE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: AMG60136
LinkDB All DBs
Position
complement(3989187..3990083)
Genome map
AA seq 298 aa AA seqDB search
MNKENVKLAIAPIGWTNDDMPDLGSENTFQQTVSEMALAGFTGSEVGSKYPRDPAILKPM
LDIRGIEICNAWFSTFFANGDKEKTIEQFIEHMNFLHAMGARVIGCSEQSKSIQGTTLAV
FEEKAIFSDEEWQLTAEGYNELARIAAEKGMRVTLHHHMGTGIQTTEEIDRFMAMTDEQV
GLLYDTGHVYYSEGSQQKMLAVLEKYLPRIFHVHLKDVRDDVVAEVRENHLSFLEGVKKG
TFTVPGDGVIDFKPVFKILDDYGYKGWMVVEAEQDPALANPLEYAVKARKYIRENTGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagagaatgtaaaactggcgatcgcgccgataggctggaccaacgatgacatg
ccggatctcggcagtgaaaataccttccagcagaccgtcagtgagatggcgctggcgggc
ttcaccggcagcgaagtgggcagcaaatacccgcgcgatccggcgattctgaaaccgatg
ctcgacattcgtggcatcgaaatctgcaacgcctggttcagcacctttttcgctaatggc
gacaaagagaaaaccatcgagcagttcatcgagcacatgaacttcctgcatgcgatgggc
gcgcgggtgattggctgttctgagcagagtaaaagtattcagggcactacgctggcggtg
tttgaagaaaaagcgattttcagcgatgaagagtggcagctaaccgcagaaggctacaac
gaactggcccgcatcgcagcagagaaggggatgcgcgtgacgctgcatcaccacatgggc
accggcattcagacgacggaagagatcgaccggtttatggcgatgaccgacgagcaggtc
ggtttgctctatgacaccggccatgtctactactccgaaggttcccagcagaagatgctg
gcggtactggaaaaatatctgccgcgcatcttccacgttcatctcaaggatgtgcgtgat
gacgtggtggctgaggtgcgcgagaatcatctctcgttcctggaaggggtaaaaaagggc
acctttaccgtgccgggcgatggcgtgatcgactttaagccggtgtttaaaatcctggac
gattatggctacaaaggctggatggtggtggaagcggagcaggatccggcgctggccaat
ccgcttgagtatgcggtgaaagcgcggaaatatatccgggaaaatacagggttataa

DBGET integrated database retrieval system