KEGG   Planktothrix agardhii: NIES204_00400
Entry
NIES204_00400     CDS       T05658                                 

Gene name
cysK
Definition
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00270  Cysteine and methionine metabolism
pagh00920  Sulfur metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NIES204_00400 (cysK)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NIES204_00400 (cysK)
Enzymes [BR:pagh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     NIES204_00400 (cysK)
SSDB
Motif
Pfam: PALP MtrG
Other DBs
NCBI-ProteinID: BBD52783
UniProt: A0A2Z6C9Y6
LinkDB
Position
complement(45035..45970)
AA seq 311 aa
MRIAHNITELVGNTPLVQLNRIPKAEGCVAQIVVKLEGMNPSASVKDRIGVNMINVAEKE
GMITPGKTVLVEPTSGNTGIALAMVAAARGYRLILTMPETMSSERRAMLKAYGAELELTP
GIEGMSGCIRRAQEIVDTLPDAYMLQQFQNPANPQIHRKTTAEEIWADTDGSVDILISGV
GTGGTLTGIAEVLKQRKTDFQAIAVEPANSPILSGGKPGPHKIQGIGAGFVPPVLNVDMI
DEVIQVTDENAMIFGRRISREEGILSGISTGAALYAAIQVGKRPENKGKLIVLIQPSFGE
RYLSTPLFQEG
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcgtatcgcccataacattacggaattagtcggtaacacccccctcgtccaactcaac
cggattcccaaggcggaagggtgtgtggctcaaatagtggtcaaattagaaggcatgaac
ccctcggcttcggtcaaggatcgaattggggtgaatatgattaatgttgctgaaaaagaa
ggaatgattactccgggtaagacggtattagtcgaaccaacatcgggtaatactggaatt
gccttagcaatggtggccgccgctaggggctatcgtttaattttaactatgcccgaaacc
atgagttcagaacggcgggcaatgttaaaagcctatggtgccgaattggaactcaccccc
ggaattgaagggatgagtggctgtatccgccgggcgcaggaaattgtggataccctgccc
gatgcctatatgttgcaacaatttcagaatccggccaacccccaaattcaccgcaaaacc
accgccgaggaaatttgggccgataccgatggctctgtagatattttaatctctggagtg
ggaactggagggactttaaccgggatagctgaagtcctgaaacaacgcaaaacggatttt
caggcgatcgcagtagaacccgccaatagtccaattttatccgggggtaaacctggcccc
cataaaattcaagggattggggcggggttcgttcctccggttttgaatgtggatatgatt
gacgaagtgattcaagttactgatgaaaatgccatgatttttggccgtcggatttccagg
gaagaagggattttatcgggaatttccaccggggcagccttatatgcggctattcaagtg
ggtaaacgtcctgaaaataaaggaaaactgattgttttgatccagccaagtttcggtgaa
cgttatttgagtacacctttatttcaagagggttga

KEGG   Planktothrix agardhii: NIES204_05920
Entry
NIES204_05920     CDS       T05658                                 

Definition
(GenBank) cysteine synthase A
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00270  Cysteine and methionine metabolism
pagh00920  Sulfur metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NIES204_05920
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NIES204_05920
Enzymes [BR:pagh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     NIES204_05920
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: BBD53329
UniProt: A0A2Z6CA12
LinkDB
Position
complement(714887..715870)
AA seq 327 aa
MDIKNGFIGTIGNTPLIRLNSFSDETGCEILGKAEFLNPGGSVKDRAALYIIKDAEEKGL
LKPGGTVVEGTAGNTGIGLAHICNAKGYKCLIIIPDTQSPEKMEALRTLGAEVRPVPAVP
YKDPNNYVKLSGRLASEMENAVWANQFDNLANRIAHYETTGPEIWQQTDGKVDAWVAATG
TGGTFAGVSLFLKEKNNRIKTVVADPMGSGLYSYVKTGEITPQGNSITEGIGNSRITANM
QDVLIDDAILVDDQEAVRVVYQLLRKDGLFMGGSVGINVAAAVALAKEMGPGHTIVTVLC
DGGARYQSKLFNKEWLQERNLWPNNLD
NT seq 984 nt   +upstreamnt  +downstreamnt
atggacatcaaaaacggttttatcggcacaattgggaatacacctttaattcgattaaat
agttttagtgatgaaactggctgtgaaattttagggaaagcagaatttttaaatccgggg
gggtctgtgaaagatcgggcggctttatatattattaaagatgcagaagaaaaaggatta
cttaaacccggtggaaccgttgtagaaggaaccgcaggtaatactggtattggattagct
catatttgtaatgctaagggctacaaatgtttaattattattcccgatactcaatctcct
gaaaaaatggaagcattaagaacattaggggcagaagttcgtccggttcctgctgtccct
tataaagaccccaataattatgtaaaattatcgggacgtttggcttcagaaatggaaaat
gcagtttgggcgaatcaatttgataatttagctaatcggattgcccattatgaaacaact
gggccagaaatttggcaacaaaccgatggcaaagtagatgcttgggtggctgctaccgga
accggaggaacttttgcgggggtttcgctgtttttaaaagagaagaataatcggattaaa
accgttgttgctgacccgatgggaagtggtttatatagttatgtgaaaaccggagaaatt
acccctcaaggtaattcgatcacagaaggtattgggaatagtcgaatcacggcaaatatg
caggatgttctaattgatgatgcgattttagtcgatgatcaagaagctgtacgggtggtt
tatcaactattaagaaaagacggattatttatggggggttccgttggcattaatgtggcg
gcggccgtagctttagcgaaagaaatgggcccaggtcataccattgtaacggttttatgt
gatggaggtgctcgctatcaatctaaattgtttaataaagaatggttacaggaacggaat
ctctggccgaataatttagattag

DBGET integrated database retrieval system