KEGG   Planktothrix agardhii: NIES204_00540
Entry
NIES204_00540     CDS       T05658                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00030  Pentose phosphate pathway
pagh00500  Starch and sucrose metabolism
pagh00520  Amino sugar and nucleotide sugar metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_00540 (pgi)
   00030 Pentose phosphate pathway
    NIES204_00540 (pgi)
   00500 Starch and sucrose metabolism
    NIES204_00540 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    NIES204_00540 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_00540 (pgi)
Enzymes [BR:pagh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     NIES204_00540 (pgi)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NIES204_00540 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   NIES204_00540 (pgi)
  Exosomal proteins of colorectal cancer cells
   NIES204_00540 (pgi)
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-ProteinID: BBD52797
UniProt: A0A2Z6C8P5
LinkDB
Position
complement(58649..60238)
AA seq 529 aa
MDATALWQRYQDWLYYHDSLGLYLDISRMGFDNDFVASLSPKFDQAFKAMDALEKGAIAN
PDENRMVGHYWLRDPDLAPTQDLKQEIVETLEKIETFTAKIHQGEIKPPNAAQFTDILSI
GIGGSALGPEFVAEALAPDHPVLNIHFIDNTDPRGIDRVLAKIGDRLKSTIVLVISKSGG
TPEPRNGMIEVRNAFSAQNLNFAQQAVAVTGVGSKLDQQAHAEGWLTTFPMADWVGGRTS
ELSAVGLLPAALQGIEIREMLAGGKAMDIATRKPEVKTNPAALLALAWYYAGNGKGEKDM
VVLPYKDSLLLFSRYLQQLVMESLGKEKDLDSNIVYQGIAVYGNKGSTDQHAYVQQLRDG
VPNFFATFIEVLQDRSLPSIEVEPGVTSGDYLSGFLLGTRQALYENHRDSITITVPEVNP
EIVGALIALYERAVGLYASLVNINAYHQPGVEAGKKAAAEVLELQHKIIQVLQDAGQALS
LETLAEKAGVPDQIEAIYKILRHLATNQRGVLLVGNLAKPASLMASIHW
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggatgccactgcactctggcaacgctaccaagattggctatactaccacgacagctta
ggactgtacctggatattagtcggatgggattcgacaatgattttgttgcatccttatcc
cccaagtttgatcaggcttttaaagctatggacgccttggaaaaaggagcgatcgccaac
cccgatgaaaaccggatggtcggccattattggttgcgtgaccccgatctagccccaacc
caggatctcaagcaagaaattgttgaaaccttagaaaaaatagaaacctttacggccaag
attcatcaaggggagattaaaccgccaaacgcagcccaattcactgatattttatccatt
ggcattggcggatcggctttggggcctgaatttgtggcggaagccctagccccagatcac
ccagtcctgaatattcattttattgataacactgatcctagaggcatcgatcgggttttg
gctaaaattggcgatcgcctcaaaagtaccatagtgctggtcatttctaagtccggcggc
actccagaaccccgtaacggcatgattgaggtacgaaatgccttttctgcccaaaactta
aactttgcccaacaagccgtggctgttacgggtgttggcagtaaactcgatcaacaggcc
catgctgaaggctggttaaccacctttcccatggccgattgggtggggggacgaacttct
gaattgtcggccgttgggctattacctgcggccctacaggggattgagattcgggaaatg
ttagccggggggaaagctatggatatcgctacccgtaaaccggaggtaaaaaccaatccg
gcggccttattagccttagcttggtattatgccggaaatggtaagggcgaaaaagatatg
gtggttttaccctataaagatagtttgctgttgtttagtcgttatttacaacagttagtt
atggaatctttagggaaagaaaaagacctcgatagtaatattgtctatcaaggaattgcg
gtttatggcaataaaggatcaacagatcaacacgcctatgttcaacaattacgcgacgga
gttcctaacttttttgccacctttattgaagtcttacaggatcgatccttgccttctatt
gaagtagaacctggtgtaacatcaggggattatttatcgggatttttactcggaacccgg
caagcattgtatgaaaatcatcgggattcaattaccattacggttccagaagttaacccc
gaaattgttggcgcgttaattgctttgtatgagcgggcggtgggtttatatgcgtcttta
gtcaatattaacgcttaccatcaaccgggggttgaagccgggaaaaaagcagccgcagag
gttctggaattacaacataaaattattcaagtcctccaagatgcaggtcaagctctatct
ctggaaaccctggctgaaaaggcgggagtccctgatcaaattgaagccatttataaaatt
ctgcgacatttagctaccaatcaacgaggcgtattattagtaggaaatctagcaaaacca
gcatccttaatggcaagtattcactggtaa

DBGET integrated database retrieval system