KEGG   Planktothrix agardhii: NIES204_00730
Entry
NIES204_00730     CDS       T05658                                 

Definition
(GenBank) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_00730
Enzymes [BR:pagh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     NIES204_00730
SSDB
Motif
Pfam: TAL_FSA
Other DBs
NCBI-ProteinID: BBD52816
UniProt: A0A2Z6C8P1
LinkDB
Position
78470..79111
AA seq 213 aa
MALYLDSAIISEAQIVKDWGWVKGLTTNPTLLAKSELSPEETLKQLKQLISGEIYYQLIA
SDFQGMVREGKKAFELLGEQTVLKIPATSVGFQTVAYLSAEIPCSVTAIYSAAQAAVAME
AGAKYAIAYVNRATRLLGDGIELVKQMNDILTGSPTKILAASIKSPQEAAATLQAGAHHL
TLPLEILRAITTHELSEQTVIEFNQNGRGIGAG
NT seq 642 nt   +upstreamnt  +downstreamnt
atggctttatatttggattcggcaattatttcagaagcacaaatagttaaagattgggga
tgggtgaaaggacttacaaccaatcctactttattggcaaaaagtgaattatctcctgaa
gaaaccttaaaacagttaaaacaattaatttcgggggaaatctattatcaattaatagca
tcggattttcagggaatggtaagggaaggaaaaaaagcctttgaattactaggagaacaa
acggttttaaaaattccagcgacttccgtaggatttcaaacagttgcctatttatctgcc
gaaataccctgttctgtgactgccatttatagtgccgcccaagctgctgtagcgatggaa
gcgggggccaaatatgcgatcgcctatgtgaatcgggcaactcgattattaggggatggt
attgaattagtcaaacaaatgaacgacatattaacaggaagtccgactaaaatattagcc
gccagtattaaatccccccaggaagccgctgccaccctacaagccggagcccatcattta
accttacccttagaaatcttaagggcaatcacaacccatgaattatcagaacaaactgtt
atagagtttaatcaaaatggtcggggaatcggtgctggttaa

KEGG   Planktothrix agardhii: NIES204_05180
Entry
NIES204_05180     CDS       T05658                                 

Definition
(GenBank) transaldolase/EF-hand domain-containing protein
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_05180
Enzymes [BR:pagh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     NIES204_05180
SSDB
Motif
Pfam: TAL_FSA BAT
Other DBs
NCBI-ProteinID: BBD53255
UniProt: A0A2Z6CA17
LinkDB
Position
629261..629938
AA seq 225 aa
MGQTLLEQLREITVVVADTGDIQAIEMYTPRDATTNPSLITAAAQMPQYESIVDDTLKKA
RQDLGGSATPAEVANLAFERLAVAFGLKILAIIPGRVSTEVDARLSYDTETTIAKGRYII
EQYEAAGISRDRILIKIASTWEGIKAAEVLEKDGIHCNLTLLFGIHQAIACAEAGATLIS
PFVGRILDWYKKDTGRDSYPPQKTPEFYLSPKFITIIKNLAIKQK
NT seq 678 nt   +upstreamnt  +downstreamnt
atgggacaaactctactcgaacaactacgggaaatcaccgttgtcgtggcggataccgga
gatatccaagccattgagatgtatacccccagagatgcaaccaccaacccctccttaatt
actgccgctgcccaaatgccccaatatgaaagtattgtggatgataccctcaaaaaagct
cgtcaggatttgggagggagtgcaacgcctgctgaagtggcaaatttagcttttgaaagg
ttagccgttgcttttggattaaagatattagctattattcccgggcgcgtctccacggaa
gtcgatgctcggttatcttatgatacggaaaccaccattgctaaaggtcgttatattatc
gagcaatacgaagcggcggggatttctcgcgatcgcattttaattaaaattgcctcaact
tgggaagggattaaagcagccgaagtcctagaaaaagatgggattcattgtaatttaacc
ctattatttggcattcatcaagcgatcgcctgtgcagaggctggagcgaccttaatttct
ccctttgtcggccggattttagattggtacaaaaaagacaccggacgagattcctacccc
ccgcagaagaccccggagttctatctgtcacccaaatttataactattataaaaaatttg
gctatcaaacagaagtga

KEGG   Planktothrix agardhii: NIES204_05190
Entry
NIES204_05190     CDS       T05658                                 

Definition
(GenBank) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_05190
Enzymes [BR:pagh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     NIES204_05190
SSDB
Motif
Pfam: TAL_FSA EF-hand_5 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 RNA_pol_Rpb5_C ZnuA
Other DBs
NCBI-ProteinID: BBD53256
UniProt: A0A2Z6C9W4
LinkDB
Position
629938..630438
AA seq 166 aa
MGASFRNIGEITELAGCDLLTISPALLEELQSTIGDLPRKLNPETAASLDLEKISIDQDT
FNRMHAEDPMASEKLEEGIKGFSKALEALEKFLAERLARLEGEEVISHAAEDIFRAYDLD
GDGYITREEWSGTDAVFDALDQDNDGQITAEEMAAGLGVSFNLAPV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgggggctagtttccgtaatattggggaaattaccgagttagccggatgtgatttatta
acaatttctcccgctctattagaagaattacaatcaactattggcgaccttccccgcaaa
ctcaatcccgaaaccgccgccagtttagacctagaaaaaatctccattgatcaagatacc
tttaaccgaatgcacgccgaagatccgatggcttcggaaaaattagaagaaggaattaaa
gggttttccaaggccttagaagccctagaaaaattcttagctgaacgtctagctcgttta
gaaggagaagaagtaattagtcatgcagctgaagatattttccgcgcctatgatttagat
ggcgatggctatattacccgggaagaatggtcaggaacagacgccgtatttgatgccctc
gatcaagataatgatggtcaaattaccgccgaagaaatggccgccgggttgggggtatcc
ttcaacttagccccggtttaa

DBGET integrated database retrieval system