KEGG   Planktothrix agardhii: NIES204_00860
Entry
NIES204_00860     CDS       T05658                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_00860 (rpiA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_00860 (rpiA)
Enzymes [BR:pagh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     NIES204_00860 (rpiA)
SSDB
Motif
Pfam: Rib_5-P_isom_A DeoRC
Other DBs
NCBI-ProteinID: BBD52829
UniProt: A0A2Z6C8P9
LinkDB
Position
94895..95605
AA seq 236 aa
MSQPDPVTLMKQYVGKAAADRVQSGTIVGLGTGSTTAYAIQYIGERLQSGELKDIKGIPT
SFQATVLAKQYGIPLTTLDEVDHIDIAIDGADEVDPSKNLIKGGGAAHTREKIVDSLAEV
FIVVVDNSKLVDRLGSTFLLPVEVIPMAMTPVMKALEKLGGKPTLRMGVKKAGPVVTDEG
NLVIDVKFDLLENPAELEKEINNIPGVLDNGLFVGVADIILVGEVIDGEAKVREIL
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagccaaccagatcccgtaacattaatgaaacagtatgtgggcaaagccgccgccgat
cgagtacaatcgggaacgattgttggactcggaactggttccaccacagcctatgcgatt
cagtatattggagaacggctccaaagtggagaactcaaagatattaaaggcattcctacc
tcctttcaagccacagtattagccaaacaatatggcattccattaaccacattagacgaa
gtggatcacattgatattgccattgatggtgctgatgaagttgatcctagcaaaaattta
attaaaggaggtggggctgcccatacccgtgagaaaattgttgatagtttggcagaagtt
tttattgtagttgtcgataattctaaactggttgatagactcggatcaacttttttatta
cccgttgaagtgattccgatggcgatgactccagtgatgaaagccctggaaaaattaggg
ggaaaaccgaccctaagaatgggggtaaaaaaagcggggccagtggtgacagatgaagga
aatttggtgattgatgttaagtttgatctgctggaaaatcccgccgaattagaaaaagaa
atcaacaatattcctggggttttagataatggtttatttgtgggggttgctgatatcatt
cttgtcggtgaagttatcgacggagaagcgaaagttcgagaaattttataa

DBGET integrated database retrieval system