KEGG   Planktothrix agardhii: NIES204_01520
Entry
NIES204_01520     CDS       T05658                                 

Definition
(GenBank) 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_01520
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_01520
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     NIES204_01520
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     NIES204_01520
SSDB
Motif
Pfam: Aldolase DHO_dh TMP-TENI
Other DBs
NCBI-ProteinID: BBD52894
UniProt: A0A2Z6C9K4
LinkDB
Position
complement(204677..205321)
AA seq 214 aa
MNSELWLSWLKKYRAIAVIRTRQRQLGKQMAQATAAGGMGLIEITWNSDQAPELIAELRS
ELPECLIGTGTLFTIEDVQNAIASGAQFLFSPHTNPDMIQVAKQAEIPIIPGALSPTEII
TAWQAGASCVKVFPISAVGGVDYIRSIKGPMGNIPLIPTGGVTLNNAVEFIQAGAIAVGL
AGDLFPPDLIGEQNWQAIAKKTQTLLQQFSEISL
NT seq 645 nt   +upstreamnt  +downstreamnt
gtgaattctgaactttggttatcttggttaaaaaaatatcgagcgatcgccgttatccgc
actcgccaaaggcaactcggaaaacaaatggctcaggcgaccgccgccggaggcatgggg
ttaattgaaattacttggaatagcgatcaagccccagaattaattgcggaattacggtct
gaattgccagaatgtttgatcggaactggaacattatttaccattgaagacgtgcagaat
gcgatcgcatccggggcgcaattcctattttctccccataccaaccctgatatgattcag
gtggcaaaacaagcggaaattcccataattcccggggcattatcccccaccgaaatcatc
accgcctggcaagcaggggctagttgtgttaaagtatttcctatttctgcggtcggtggt
gtagattatattagaagtattaaagggccgatgggaaatatccccttgattcccacggga
ggggtaactttaaacaatgctgttgagtttattcaagcgggagcgatcgcggtgggactg
gctggagatttatttccacctgatttaattggagaacaaaattggcaagcgatcgccaaa
aaaactcaaaccctcctacaacagttctcggaaatttccctataa

DBGET integrated database retrieval system