KEGG   Planktothrix agardhii: NIES204_02320
Entry
NIES204_02320     CDS       T05658                                 

Gene name
gcvT
Definition
(GenBank) putative glycine cleavage T-protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00670  One carbon pool by folate
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_02320 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_02320 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NIES204_02320 (gcvT)
Enzymes [BR:pagh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     NIES204_02320 (gcvT)
SSDB
Motif
Pfam: GCV_T GCV_T_C DUF2106
Other DBs
NCBI-ProteinID: BBD52974
UniProt: A0A2Z6C9T0
LinkDB
Position
complement(296336..297466)
AA seq 376 aa
MTTTLSHTPLYNVSVELNGRMVPFAGWEMAVQFSGINREHEAVRQAVGMFDISHMGKFIL
RGEKLIEALQSLVPSDLSRLQPGEAQYSALLNAQGGILDDIIFYDQGIDPVTNLPQGVMI
VNAATKSRDKAWIIAHIEDQAIVLEDLSRDKVLLAVQGPQAEATLQPFVGDSLSEVKFFG
HITTTVLGKPAFIARTGYTGEDGFEVMVAPSVGVELWKSLATAGVIPCGLGARDTLRLEA
AMALYGQDISLTTTPLEAGLNWIIHWETKGKFIGRQALEQQKAAGVTQKLVGLEMQGRHI
ARHGYPVLFNGQTVGEITSGTLSPTLGKAISMAYVPTALSKIGQSLDIEIRGKTYPATVV
KRPFYRSPNRPKNPKT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgacaacgaccctttctcatactcccctgtataacgtctccgttgaactgaatggccgc
atggtgcccttcgcaggttgggaaatggcggttcaatttagcggaattaaccgagaacat
gaagctgtccgtcaagcggtgggaatgtttgatatctcccacatgggcaaatttattctg
cgtggggaaaaactcatcgaagccttacaatcccttgtcccttcggatttgagccgttta
cagccaggtgaagcccaatatagcgccctcttaaatgcccaggggggaattttagacgat
attattttttatgatcaggggattgacccggtaacgaatctgccgcaaggggtaatgatt
gtgaatgcggcgacaaaatccagagataaggcttggatcattgcccatattgaggatcag
gcgatagtattagaagacttatcgcgagataaagtcctattagcggttcaagggccccag
gctgaagccacattacagccttttgtcggggatagtctttctgaagttaaattttttggt
catattaccaccaccgtactcggaaaaccagccttcatcgcccgcaccggatacaccgga
gaagatggttttgaagtgatggttgctccttctgttggtgtggaattatggaaaagttta
gccactgcgggggtaattccctgtggtttaggtgctagagataccctgcgtttagaagcg
gcaatggctttatatggacaagatattagtttaactacaactcccttagaagcgggttta
aattggattattcattgggaaactaaaggaaaatttattggtcgtcaagctttagaacag
caaaaagctgccggagtaactcaaaaattagtcggtttagaaatgcaaggacgccatatt
gctcgtcacggatatccggttttatttaatggtcaaaccgtgggagaaattaccagtgga
actctatcaccaacgttaggaaaagccatttctatggcctatgttcccacagcattatcc
aaaattggtcaatctttagatattgaaattcggggcaaaacctacccagcaacggtggtt
aaacgtcccttctatcgttctcctaatcgtcccaaaaacccaaaaacctaa

KEGG   Planktothrix agardhii: NIES204_23670
Entry
NIES204_23670     CDS       T05658                                 

Gene name
gcvH
Definition
(GenBank) glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_23670 (gcvH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_23670 (gcvH)
SSDB
Motif
Pfam: GCV_H
Other DBs
NCBI-ProteinID: BBD55067
UniProt: A0A2Z6CEW6
LinkDB
Position
complement(2692011..2692388)
AA seq 125 aa
MTSYPEDLRYLDSHEYVRLDGEIATIGITEFAVSQLGDIVFVELPNVEDEIEKGEKFGTV
ESVKAVEELISPIGGIVIECNTTLEDSPEILSDDPYGDGWLIKVKITDSSDLDDSLSAEQ
YQALV
NT seq 378 nt   +upstreamnt  +downstreamnt
atgacatcctatcctgaagacctgagatatttagatagccacgaatacgtcagacttgat
ggtgaaatcgccaccattgggataactgagtttgctgtgagtcaacttggagatattgtc
tttgtggaattaccaaatgtagaggatgaaattgagaagggagaaaagtttggaacagtt
gagtctgtgaaagccgtggaagaattgatttcaccgataggcggtatagtgattgaatgt
aatactacccttgaagattcccctgaaattctatcagatgatccctatggagatggatgg
ttaatcaaagttaaaatcactgattctagtgatttagatgatagcttatccgcagaacaa
tatcaagccttagtttaa

KEGG   Planktothrix agardhii: NIES204_40740
Entry
NIES204_40740     CDS       T05658                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00260  Glycine, serine and threonine metabolism
pagh00280  Valine, leucine and isoleucine degradation
pagh00310  Lysine degradation
pagh00380  Tryptophan metabolism
pagh00620  Pyruvate metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_40740 (lpdA)
   00020 Citrate cycle (TCA cycle)
    NIES204_40740 (lpdA)
   00620 Pyruvate metabolism
    NIES204_40740 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_40740 (lpdA)
   00640 Propanoate metabolism
    NIES204_40740 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_40740 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    NIES204_40740 (lpdA)
   00310 Lysine degradation
    NIES204_40740 (lpdA)
   00380 Tryptophan metabolism
    NIES204_40740 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_40740 (lpdA)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NIES204_40740 (lpdA)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NIES204_40740 (lpdA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored FAD_binding_2 GIDA K_oxygenase 3HCDH_N UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BBD56740
UniProt: A0A2Z6CK98
LinkDB
Position
complement(4500989..4502419)
AA seq 476 aa
MDYDLVIIGAGVGGHGAAIHAVGCGLKTAIIEAADMGGTCVNRGCIPSKALLAASGRVRE
LHNTHHLKNLGIQLGQVSFDREQIANHADNIVTKLRGDLTNSLKRLGVDVIQGWGKIAGA
NKVTVETTNGEKTITAKDIILAPGSVPFVPPGITIDHQTVFTSDDAVKLASLPQWIAIIG
SGYIGLEFSDIYTALGCEVTMIEALDQLMPTFDPDIAKLAQRVLINPRDIETKVGKLALK
VTPGSPVIIELADTKTKEVEEVLEVDACLVATGRIPVSKNLGLESVNVEPIRGGFIPTND
HLEVLSGGEPVPHLWAIGDATGKMMLAHTASAQGVAVVETICGRPRAVDYRSIPAAAFTH
PEISYVGLTEPAAKELGQTEGFEIATVKTYFKGNSKAIAEGETEGMAKVIYRKDTGEILG
VHIFGLHASDLIQEAANAMYHRQSVHDLVFSVHTHPTLSEVLDEAYKRAVFSVGGH
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggattacgatttagtgattattggtgcgggagtgggcggacatggtgctgctatccac
gccgtcggttgtggcttgaaaaccgcaattattgaggcggcggacatggggggaacttgt
gttaaccgaggctgtattccctctaaagcgttattagcggcgtcgggacgggtcagagaa
ttacataatacccatcacttaaaaaatttagggattcagttaggacaagtcagttttgat
cgtgaacaaattgctaaccatgctgataatattgtcactaaacttcggggtgacttgact
aatagtttgaagcggttaggggttgatgtaattcaaggttggggtaaaattgccggggcg
aataaagttaccgttgaaactactaacggagaaaaaacaattaccgctaaagatattatt
ttagcaccgggttctgtgccttttgttcccccaggaattacgattgatcatcaaacagtt
tttaccagtgatgatgcggttaaattagcatccctaccccaatggattgcgattattgga
agtggctatatcggattagaattttctgatatttatacggctttaggttgtgaagttacc
atgattgaagccttagatcaattaatgccaacttttgatcctgatattgctaaattagct
caacgggttttaattaatcccagggatattgaaactaaagtcggaaaattagccttaaaa
gtaacgcctggttctccggttattattgagttagccgataccaaaactaaagaagtagaa
gaagtactagaagtggatgcttgtttggttgctaccgggcggattccggtgagtaaaaat
ttaggtttagaatcggtgaatgttgaacctattcggggcggttttattcctacaaatgat
catttagaggtattgtctggaggcgaacctgttccccatttatgggcgattggagatgcg
acgggtaaaatgatgttagcccataccgcatccgcccagggagtagccgttgtagagact
atttgcggacgtcctcgcgccgtagattatcgtagtattccggcggctgcttttacccat
cctgaaattagttatgtgggtttaactgaacctgctgcaaaggaattaggacaaacagaa
gggtttgaaattgcaacggtaaaaacctattttaagggtaattctaaagcaattgcggag
ggagaaaccgaaggtatggctaaagtgatttatcggaaagatacgggggaaattttagga
gttcatatctttggtcttcatgcttctgatttaattcaagaagcggcaaatgctatgtat
caccgtcaatctgtccatgatttagtcttctcagttcatacccatcctaccctttcagaa
gtgcttgatgaagcctacaaacgggctgtttttagtgtggggggtcattag

KEGG   Planktothrix agardhii: NIES204_41830
Entry
NIES204_41830     CDS       T05658                                 

Definition
(GenBank) glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_41830
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_41830
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     NIES204_41830
SSDB
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-ProteinID: BBD56848
UniProt: A0A2Z6CK89
LinkDB
Position
complement(4616887..4619805)
AA seq 972 aa
MLEITSSASTQMETIVSSAPKGNEKAPQFQGFAKRHLGPNPVEIQQMLELLGVSSLETLI
DQTIPSTIRLNYSLKLPEAQTEYAALNQLKAIASQNQVYRSFIGMGYSDCITPGVIQRNI
LENPGWYTAYTPYQAEIAQGRLEALLNFQTLIIDLTGLEIANASLLDEATAAAEAMSLSY
AVFKTKATGFFVSQDCHPQTIDVVKTRAIPLGIEIIIGDHHTFDFSTSIFGCLLQYPTTD
GTIYDYRNFIETAHKHNALVTVAADILSLTLLTPPGELGADIAVGSTQRLGVPLGYGGPH
AAYFATKETYKRNVPGRMVGVSKDAQGNPALRLALQTREQHIRRDKATSNICTAQVLLAV
IASLYAVYHGPSGLQEIAQNIHQLTLTLAEGLKRLGYAMGTEPFFDTIKVELGQKSLTEI
LLASQTKEINLRVIDSETVGISLDETTTINDIIDLWEIFAESELKFTVEDVLNPSENLTP
FIRKSAYLTHPVFNSYHSETELLRYIHRLETKDLSLTTSMIPLGSCTMKLNATAEMIPVT
WPELGKLHPFAPKEQTQGYQILFEQLENWLAEITGFSGISLQPNAGSQGEYAGLLVIRHY
HESRGEINRNICLIPESAHGTNPASAVMCGFKVVSVACDDQGNININDLQAKAEKYHENL
AALMITYPSTHGVFETGIEDICNIIHSNGGQVYMDGANMNAQVGLCRPGDFGADVCHLNL
HKTFCIPHGGGGPGMGPIGVAAHLVPFLPGHGVVDISGSQTGAVSAAPWGSASILVISWM
YIAMMGPKGLTEATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGI
EVDDIAKRLMDYGFHAPTVSWPVAGTMMVEPTESESKPELDRFCDAMIAIYQEISQIESG
AMDATNNMLKNAPHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRN
FVCSCLPMDAYE
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgttagagattacttcctcagcgagcacccagatggaaaccatagtatcttccgccccc
aagggtaacgaaaaagctcctcaattccaggggtttgccaaacggcatctaggccccaat
cctgttgagattcaacaaatgttagaattgttaggggtttctagtttagaaactttaatt
gatcaaacaattccctcaactattcgcctcaattatagcttaaaattaccagaagctcaa
accgaatatgcggctttaaatcaattaaaagcgatcgcctctcaaaatcaagtctatcgt
tcttttattggcatgggatactccgattgtatcacacccggagtgattcaaagaaatatc
ctagaaaatcccggttggtatacggcttataccccctatcaagcggaaattgcccaaggt
cgtttagaagcattactaaactttcaaaccctaattattgacttaactggattagaaata
gctaacgcttccctactcgatgaagctacagccgccgccgaagccatgagtctaagttat
gcggtttttaaaaccaaagctacgggattttttgtctcccaagattgtcaccctcaaact
attgatgtagttaaaaccagggcaattcccctaggcattgagattattattggagatcat
catacctttgattttagcacatctatctttggatgtctactgcaatatcctactactgat
ggaacaatttatgactatcgaaactttatagaaaccgcccacaaacataacgctttagtc
accgtggcggcggatattttaagtttaaccctattaacacctccaggggaattaggagca
gatattgccgtcggaagtacccaacggttgggggttcccttgggttatggcggcccccat
gcagcctattttgctaccaaagaaacctataaacgcaacgttccgggtcggatggtgggt
gtgtctaaagatgctcaaggaaacccggcgttacggttagcattacaaacccgtgagcaa
catattcgccgtgataaagctaccagtaatatttgtacagcccaggtattattagcggta
attgcgagtttgtatgcggtatatcatgggccatctggacttcaagaaatcgcccaaaat
attcatcagttaaccctaaccttagcagaaggcttaaaacggttaggctacgcaatggga
acagaaccattttttgatacaattaaagtagaattagggcaaaaatccttaacggaaatt
ctgttagcatcccaaaccaaagaaattaatctccgagtgattgattccgaaaccgttggt
attagtttagatgaaactaccacaattaatgatatcattgatttatgggaaatctttgcc
gaatctgaattaaagtttacggttgaagatgtcttaaacccatcagaaaatcttacccca
tttatccgaaaatctgcctatttaacccatccggttttcaacagttaccattcagaaacc
gaacttctacgctatattcatcgtttagaaactaaggatttatccttaactacttccatg
attcctttgggttcctgtacaatgaaattgaatgccacggcggagatgattccggtaact
tggccagaattgggaaaactccatcccttcgccccaaaagagcaaacccaaggctatcaa
attctgtttgaacaattagaaaattggttagcagaaataacaggattttccgggatttct
ttacaaccaaatgcaggttcccagggggaatatgccggattattagtaattcgtcactac
catgaaagtcggggagagataaaccgaaatatctgtttaattcccgaatctgcccacggt
acaaaccctgctagtgcggtgatgtgcgggtttaaagtagtttctgttgcctgtgatgat
caaggaaatattaatattaatgacttgcaagctaaggccgaaaaatatcacgaaaattta
gctgcattaatgattacctatccctcaactcacggcgtatttgaaaccggaattgaagac
atttgtaatatcattcacagcaatggcggacaggtttatatggatggggcaaatatgaac
gcccaagtcgggttatgtcgccctggggattttggcgccgatgtctgccacctcaacctg
cataaaaccttctgtattccccacgggggcggtgggccaggaatggggccgattggggtt
gctgcccatttagttccctttctccccggtcatggggtcgtagatatctcaggaagtcaa
accggggccgtttccgccgccccttgggggagtgcgagtatcctggtgatttcttggatg
tatattgccatgatggggccaaagggattaacagaagcgacaaaactggcaattttaaat
gcgaattatattgccagtcgtttagataaatattacccgattttgtacaagggaaatcag
ggatttgttgcccatgaatgtattttagatttgcggggcgtgaagaaatctgcgggtatt
gaagttgatgatattgctaaacgattaatggactatggattccatgcccccacggtttct
tggccagtagctggaaccatgatggtagaaccaactgaaagcgaatctaaaccggaatta
gatcggttttgtgatgcgatgattgccatttatcaggagatttcccagatagaatcgggg
gcgatggatgccactaataatatgttgaaaaacgcgccccatacggcaatttccctgctt
tgtggcgaatggaatcatccctattcccgtgaacaagccgcctatcccgccccctggaca
aaagaacataaattctggccgtctgtgggacgaattgataatgcttttggcgatcgcaat
tttgtctgttcctgcttacccatggatgcctatgaataa

DBGET integrated database retrieval system