KEGG   Planktothrix agardhii: NIES204_02370
Entry
NIES204_02370     CDS       T05658                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13979  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00561  Glycerolipid metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_02370
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    NIES204_02370
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     NIES204_02370
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_2 Oxidored_nitro Glu_dehyd_C 3HCDH_N NAD_binding_7 Shikimate_DH
Other DBs
NCBI-ProteinID: BBD52979
UniProt: A0A2Z6C921
LinkDB
Position
301069..302127
AA seq 352 aa
MYNTKAYSAASATSALSSTQIGRRDLTEHDVQIEILFCGICHSDIHSVRNEWSSVMPTTY
PIVPGHEIVGRVTQVGSAVTKYKPDDLAAVGCLVDSDGTCPHCQANLEQFCPNLTFTFNS
PDKHLGGVTYGGYSDSIVVDERFVLRVPTNLNLPGVAPLLCAGITTYSPLRHWGVTKGKK
VGVVGLGGLGHMGVKFAHAFGAHVVVFTTSPDKKEDALRLGADEVVVSRNADEIQQHAGS
FDFILDTVSANHDINAYLNLLRLDGNITLVGVPEKPLDVSAFSLIMARRSLSGSSIGGIA
ETQEMLDFCGKHNITADVEVIPIQKVNEAYERLLKSDVKYRFCIDMASLKSA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgtacaacacgaaagcttattccgcagccagtgcaacatcagcgctgtcctccacccag
atcggacgacgggatctaaccgaacacgacgtacagattgagatccttttctgcggtatc
tgccactccgacatccattcggtgcgtaacgagtggagcagcgtcatgcccactacctac
ccaattgtccccggtcatgagatcgtcggccgtgttacccaggttggctcggcagttacg
aagtacaagcccgatgacctcgctgcggttggttgcctggttgactccgatggtacttgc
ccccattgccaagctaatcttgagcagttctgcccgaacctaaccttcaccttcaactct
cccgacaagcacctcggaggcgttacttatgggggctactccgatagtattgttgttgat
gaacgcttcgttctacgagttcctactaacctcaatctccctggagtcgcgccacttctg
tgcgccgggattacaacctactcacccctgcgtcactggggcgttactaaaggtaagaaa
gttggcgtggtcggtcttggtgggctcggtcacatgggggtgaaatttgctcatgcgttt
ggagcccatgtcgttgtctttacgacttcacccgataagaaagaagacgcgctccgtctt
ggtgccgacgaagtggttgtctcccgcaacgccgacgagattcagcagcacgctggcagt
ttcgattttattctcgataccgtctccgctaatcacgatattaacgcctatctcaacctg
cttcgccttgacggtaacatcacccttgtcggtgtcccggagaaacccctggatgtttcg
gcattcagcctgatcatggctcgccgcagtctttctggctctagcatcggtgggatcgcc
gaaacccaagagatgctcgacttttgtggcaaacacaacatcactgccgatgtcgaagtt
atcccaatccagaaggttaacgaagcctacgagcgactgctcaagtccgatgtgaagtac
cgcttctgcatagatatggcatcccttaaatctgcataa

DBGET integrated database retrieval system