KEGG   Planktothrix agardhii: NIES204_02420
Entry
NIES204_02420     CDS       T05658                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00620  Pyruvate metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00640  Propanoate metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_02420 (acs)
   00620 Pyruvate metabolism
    NIES204_02420 (acs)
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_02420 (acs)
   00640 Propanoate metabolism
    NIES204_02420 (acs)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_02420 (acs)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pagh01004]
    NIES204_02420 (acs)
Enzymes [BR:pagh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NIES204_02420 (acs)
Lipid biosynthesis proteins [BR:pagh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NIES204_02420 (acs)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-ProteinID: BBD52984
UniProt: A0A2Z6C9T9
LinkDB
Position
complement(304967..306934)
AA seq 655 aa
MSQPTIESILQENRLFQPNPEFSQNAHIKTLEEYKQLYEKAKANPEAFWAELAETELHWF
QKWDQVLDWQPPFAKWFVNGKINISYNCLDRHLTTWRKNKAALIWEGEPGDTRTLTYFQL
HREVCQMANVLKQLGAQKGDRIGIYMPMIPEAAIAMLACARIGAPHTVVFGGFSGEALKD
RLVDAEAKLVITADGGWRKDAIVPLKEQVDKAIEAGATSIDNVLVVQRTNQKINMEPGRD
HWWHDLRQGVSADCPAEPMDSEDMLFILYTSGTTGKPKGVVHTTGGYNLYTHITNKWAFD
LQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRTSNPGCFWDVVEKYGVTIF
YTAPTAIRSFMKMGEHHPKSRNLSSLRLLGTVGEPINPEAWMWYQRVIGNGKCPIVDTWW
QTETGGFMITPLPGATPTKPGSATLPFPGILADVVDTEGNPVTDDSGGYLVVRYPWPGMM
RTIYGDPDRFRRTYWEYLKPKDGIPLYFAGDGAHQDREGYFWVMGRVDDVISVSGHRLGT
MEIESALVSHHAVAEAAVVGKPDEIKGEEIVAFVTLEEGKEASDELAQELKKHVVKEIGA
LARPGEIRFTDDLPKTRSGKIMRRLLRSLASGQEITGDTSTLQDRSVLEKLRGGA
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgtcacaacctacgatagaatcgattctgcaagaaaatcggttgtttcaacctaatcct
gagttttcccagaatgcccacattaaaaccttagaggagtataaacaactctatgaaaaa
gctaaggccaaccccgaagcgttctgggcagaactagcggaaacagaactccattggttt
caaaaatgggatcaggttttagactggcaaccgccttttgctaaatggtttgtcaatggc
aaaattaatatttcctataattgtttagatcggcacttaaccacttggcggaaaaataaa
gccgccttaatttgggaaggagaaccgggcgatacccgaactttaacttacttccaactg
catcgagaagtctgtcaaatggcgaacgttctcaaacagttaggagcgcaaaaaggcgat
cggattggcatttatatgcccatgatacccgaagccgccattgctatgttagcctgtgcc
cgcattggtgcgccccataccgttgtctttggggggtttagcggagaagcacttaaagat
cggttagtagacgccgaagctaaattagtgattaccgccgatggtggctggcgtaaagat
gccattgttcccttaaaagaacaagtcgataaagccattgaagccggggctaccagtatt
gataacgttttagtggtacaaagaactaaccaaaaaatcaatatggaacccggacgggat
cattggtggcatgatctcagacagggagtttccgccgactgtcccgccgaaccgatggat
agtgaagatatgttatttatcctctacaccagtgggacaacgggcaaacccaagggcgtt
gttcacaccacgggcggatataacctctatacccacattaccaataaatgggcttttgac
ctacaggataccgatgtctattggtgtacggccgatgtcggttggattactggacacagt
tatattgtctatgggcccttatccaatggggcgacaaccctaatgtatgaaggagcgccg
cgtacttctaaccccggttgtttctgggatgtggtggaaaaatacggggtgacgatattc
tatactgcacccacagcaattcggtcatttatgaaaatgggagaacaccatcccaagtcc
cgtaatttatcgtctctgcgcctattaggaaccgtgggagaaccgattaaccccgaagct
tggatgtggtatcaacgggtaattggtaacggtaaatgccccattgtcgatacctggtgg
caaacggaaacgggcgggttcatgattacccccttacccggggcgactcccaccaaaccc
ggttcggctaccttaccctttcctgggattttagcggatgtggtagacaccgaaggaaat
cccgtaaccgatgatagtggtggttatttggtggtgcggtatccttggccgggaatgatg
cggacgatatatggtgaccccgatcgtttccggcgcacctattgggaatatttgaaacca
aaagatggtattcccctctattttgccggggatggagcccatcaagaccgggagggctat
ttctgggtcatgggtcgggtggatgacgtgatcagtgtgtcgggacatcgtttagggaca
atggaaattgagtcggccttagtctcccatcacgcggtggctgaggctgcggtggttggg
aaacccgatgagattaagggtgaggagattgtcgcctttgtcaccttagaagaaggcaag
gaagcgtccgatgagttagcacaggaactcaagaagcacgttgtcaaggaaattggcgcc
ttagcccgtcctggggaaattcggtttacggatgatctacctaaaacccggtctgggaag
attatgcggcgcttattgcgatcgctggcgtcgggtcaggaaattacgggagatacttct
acgctacaggatcgcagtgtattagagaaattgcggggaggggcgtaa

DBGET integrated database retrieval system