KEGG   Planktothrix agardhii: NIES204_03020
Entry
NIES204_03020     CDS       T05658                                 

Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00460  Cyanoamino acid metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00670  One carbon pool by folate
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_03020
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_03020
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_03020
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NIES204_03020
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NIES204_03020
Enzymes [BR:pagh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     NIES204_03020
SSDB
Motif
Pfam: SHMT Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: BBD53039
UniProt: A0A2Z6C980
LinkDB
Position
complement(367911..369194)
AA seq 427 aa
MSQTNLEILSETDPVIADLIQHELCRQREHLELIASENFTSAEVMAAQGSVLTNKYAEGL
PKKRYYGGCEFVDGIEQLAIERAKQLFGAASANVQPHSGAQANFAVFLAMLKPGDTIMGM
DLSHGGHLTHGSPVNVSGKWFKACHYGVSPETEQLDYDLILELAKQHKPQMLICGYSAYS
RIIDFEKFRAIADEVGAYLMADIAHIAGLVATGHHPNPIPYCDVVTTTTHKTLRGPRGGL
ILSRDAELGKKLDKAVFPGSQGGPLEHVIAGKAVAFGEALKPEFSTYSGQVVANAKALAT
QLQNRCLKIVSGGTDNHLMLVDLRSVNMTGKRADQLVSEVNITANKNTVPFDPESPFVTS
GLRLGSPAMTTRGMGETEFIEIGNIIADRLLNPEDEGIGEACRQRVANLCDRFPLYPHLS
LKVPALA
NT seq 1284 nt   +upstreamnt  +downstreamnt
gtgagtcagactaacttagaaatcttatctgaaactgatccggtgattgctgatctgatt
cagcatgaactctgtcgtcaacgggaacacctagaattaattgccagtgaaaattttacc
tcggcggaggtcatggcggcccaggggtcggttctcaccaataaatacgccgaaggactt
cccaaaaaacgctattatgggggttgcgaatttgtcgatggcatcgaacaattagccatt
gaacgcgccaaacaactattcggggctgcgagtgccaatgttcagccccattctggagcc
caagctaactttgccgtgttcttggctatgctcaaaccgggtgacacgatcatgggaatg
gacttatcccatgggggacatttaactcatggttccccggtcaatgtttccggtaaatgg
tttaaggcttgccattacggagttagcccggaaaccgaacaacttgactatgacttaatt
ttagaactggctaaacagcataaacctcaaatgctgatttgcggttattctgcctattct
cggattattgattttgagaaattccgcgccatcgccgatgaagtcggtgcttacttaatg
gctgatattgcccatattgctgggttagtggcaacgggtcatcatcctaaccctatcccc
tattgtgatgttgtcaccaccactactcacaaaaccttgagagggccaagggggggattg
attctcagccgagatgccgaactgggcaaaaaattagataaggctgttttcccagggtct
caaggtggccccctagagcacgttattgcaggcaaagccgttgcctttggggaagccctc
aaacccgagttttcgacttattctggtcaagtggttgccaatgctaaagccttagcgact
cagttacaaaaccgatgcttaaaaattgtttccggtggtacggataatcatttgatgtta
gtggatttacgttctgtcaatatgacgggtaaacgggcagatcaactggttagtgaagtg
aatattacagccaataaaaatacggttccctttgatcccgaatctccttttgtcaccagt
ggtttacggttgggatctccggccatgaccacccgggggatgggagaaacggaatttatc
gaaattgggaatattatcgccgaccgtctgttaaaccccgaagatgaaggtatcggcgaa
gcctgtcgtcaacgggtggcgaatttgtgcgatcgctttcccctctatccccatctgagt
ttgaaagttccagccttagcctag

DBGET integrated database retrieval system