KEGG   Planktothrix agardhii: NIES204_03590
Entry
NIES204_03590     CDS       T05658                                 

Gene name
gltA
Definition
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01210  2-Oxocarboxylic acid metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_03590 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_03590 (gltA)
Enzymes [BR:pagh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     NIES204_03590 (gltA)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BBD53096
UniProt: A0A2Z6C9F8
LinkDB
Position
435351..436523
AA seq 390 aa
MTAISEFKPGLEGVPATLSSVSYVDGQKGILEYRGIGIEQLANQSTFLETSYLLIWGKLP
TKDELADFEHEIRYHRRIKYRIRDMMKCFPESGHPMDALQTSAAALGLFYSRRALDNPEY
IREAVVRLLAKIPTMVAAFQLMRKGNDPVQPRDDLDYSANFLYMLNEREPDPIAARVFDV
CLTLHAEHTINASTFSAMVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLTMLEEIGSV
ENVGSYVDNLIATKSKIMGFGHRVYKVKDPRATILQQLGEQLFERFGHDEYYEIALELER
VVADRLGEKGIYPNVDFYSGLVYRKLNIPSDLFTPIFAIARVSGWLAHWKEQITKNRIFR
PTQIYTGSHNETYVPIHERNCAINLQGETL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgactgccattagtgaattcaagcccggtcttgagggtgttccggctaccttgtccagt
gttagctacgttgatggacaaaaaggcattttagagtaccgaggaattgggattgaacaa
ctggcgaaccagagtacctttctggaaacctcctatttactgatctggggaaaactcccc
accaaagatgaattagcagactttgaacatgaaattcgctatcatcgacggattaaatat
cgaattcgggacatgatgaaatgctttcccgaatctggacatcccatggacgccttacaa
acttcggcggcagctttaggactattctattctcgtcgggctttagataatcccgaatat
attcgagaagccgttgtccggttactggctaaaattcccaccatggttgcagctttccaa
ttgatgcgaaagggtaacgatcccgtacagccccgggatgatttggattattccgccaac
tttctctatatgttaaatgagcgggaacccgatccgatcgccgcccgggtctttgatgtt
tgtctcacccttcatgcggaacatactattaacgcttctacattctccgccatggtaacc
gcttctaccctcaccgatccctatgcggtagtagcttcggcggtcggaaccttagctggg
ccattacatgggggggcgaatgaggaagttttgacgatgttagaggaaattggttctgtg
gaaaatgttggctcctacgtggataatttgattgcgaccaaatctaaaatcatgggattt
ggacatcgggtttataaagttaaagatccccgggctacgattttgcaacaactaggagaa
cagctatttgaaaggtttggccatgatgaatattatgaaattgctttggaattagaacga
gttgtggctgatcgtttaggggaaaaaggcatttatcctaacgttgatttctattccggt
ttggtttaccgcaagttaaatattccctcagatctatttaccccgatttttgcgatcgcc
cgggtttcaggttggttagcccactggaaagaacaaattaccaaaaaccgcatcttccgt
ccaactcaaatttatactggttcccataatgaaacctatgttcccattcatgaacgcaac
tgcgcgattaacctacaaggagaaactctgtaa

DBGET integrated database retrieval system