KEGG   Planktothrix agardhii: NIES204_03910
Entry
NIES204_03910     CDS       T05658                                 

Gene name
pfkA_1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00030  Pentose phosphate pathway
pagh00051  Fructose and mannose metabolism
pagh00052  Galactose metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_03910 (pfkA_1)
   00030 Pentose phosphate pathway
    NIES204_03910 (pfkA_1)
   00051 Fructose and mannose metabolism
    NIES204_03910 (pfkA_1)
   00052 Galactose metabolism
    NIES204_03910 (pfkA_1)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_03910 (pfkA_1)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NIES204_03910 (pfkA_1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NIES204_03910 (pfkA_1)
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-ProteinID: BBD53128
UniProt: A0A2Z6C9N8
LinkDB
Position
469031..470113
AA seq 360 aa
MVEHKRIGILTSGGDCAGLNAAIRAVVYRAAGILGWEVFGIREATQGLMTRPVNSVPLTI
DKVDNILTAGGTILGTTNKGDPFAFPMPDGSLLDRSEEIIEGYNLLGLNALIGIGGDGSL
AILRRIAQQGNMNLIGIPKTIDNDVGSTDLSIGFSTAVDIATEALDRLHFTAASHSRVMI
LEVMGRDAGHIALHAGIAGGADIILIPELPYSLDSICQHIAERQKQGKNYCLVVVAEAVK
TETGEPVTMINRMGQARLGGIGQYLADEICDRSGAETRVTVLGHIQRGGTPSPIDRIIAS
AFGVAAVDLILEENYDRVVVWRDRNVSSIPILDAIAQYRAVNADDILVETAQSMGICLGN
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggtagaacacaaacgcattggtattttaaccagtgggggggactgtgcaggtttaaac
gcagcaattcgggctgtggtttatcgggcggcaggaatcttggggtgggaggtcttcggt
attcgagaagccacccaagggttaatgactcgtcctgttaacagtgttcctctgactatt
gataaagttgataatattctcaccgccggggggacaattttgggaaccaccaataagggt
gatccctttgcctttccgatgccggatggaagtttgttggatcgctccgaggagattatc
gaaggctataatctcttaggactgaatgctttaattggtatcggtggagatggcagttta
gcgattttgcgacgcattgcccaacagggaaatatgaacttaattgggattcctaaaacc
attgataatgacgtgggtagcacggatttatctattgggtttagtaccgccgttgatatc
gctactgaggctttagatcggctacactttaccgccgctagtcatagccgcgtgatgatt
ttagaagtcatgggccgagatgcgggacatattgccctccatgcgggaattgctggcggt
gcagatattattttaattcctgaacttccctacagtttggatagcatttgtcagcatatt
gcagaacgacaaaaacaagggaaaaactattgtttagtcgttgttgcagaggcggttaaa
acggaaacgggagaacctgtgacgatgattaatcgtatgggacaagctcgtttagggggt
attggacaatatctggctgatgaaatttgcgatcgcagtggcgcagaaacgcgagttact
gttctcggtcatattcaacgggggggaactccttcaccaattgatcggattattgcttct
gcttttggagtggcggcggtggatttgattcttgaggagaattatgatcgggttgtcgtt
tggcgagatcggaatgtatcgagtattccgattttggatgcgatcgctcaatatcgggct
gttaatgctgatgatattttagtagaaacagcccaaagtatggggatttgtttagggaat
taa

KEGG   Planktothrix agardhii: NIES204_32530
Entry
NIES204_32530     CDS       T05658                                 

Gene name
pfkA_2
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00030  Pentose phosphate pathway
pagh00051  Fructose and mannose metabolism
pagh00052  Galactose metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_32530 (pfkA_2)
   00030 Pentose phosphate pathway
    NIES204_32530 (pfkA_2)
   00051 Fructose and mannose metabolism
    NIES204_32530 (pfkA_2)
   00052 Galactose metabolism
    NIES204_32530 (pfkA_2)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_32530 (pfkA_2)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NIES204_32530 (pfkA_2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NIES204_32530 (pfkA_2)
SSDB
Motif
Pfam: PFK DAGK_cat
Other DBs
NCBI-ProteinID: BBD55934
UniProt: A0A2Z6CHY4
LinkDB
Position
complement(3653560..3654714)
AA seq 384 aa
MNKRKRIGILTSGGDCPGLNAVIRAVVNHATSEYNWEVRGIPYATKGLIERKSVVLNSYG
LERHGIDPLLSMGGTILGSINKGDTEGNTDEIIQGYYDLGLDALIAIGGDGSLAILQKLA
EKGNWNLVAVPKTIDNDVAHTELSVGFNSAVTTILDCLDRLSYTAASHDRVMVVEVMGRT
TGHLALYSGIVGGADAILIPEIPYSIKTLCKRIRELRNLWGRKFAIVVVAEGAKTADGES
RYYKDALGEVRLRGIGEYVAAEIEKNLGVEARVTVLGHVQRGGAPSALDRLIGTAFGKVA
VDLIAQETYGVMVAWHNNAVTTIPLDQVFADSPLLVDPQGFWVETARSLGIYLGEELNQE
NIPTVNPNINNLKPFSLETIAQIN
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaacaaacgtaaacgaattggcattctcaccagtggcggagactgcccgggtctcaat
gccgtgattcgggctgttgtcaatcatgccacatctgaatataactgggaagtccgaggc
attccctatgccaccaagggactgattgaacgaaaaagtgtggtattaaattcctatggt
ttagagcgacacggaattgatcccttattaagtatgggtggaaccattttagggtcgatt
aataagggagataccgaaggcaataccgacgaaattattcagggatattatgatttagga
cttgatgctttaatcgctattggtggggatggtagtctggcgattttgcagaaacttgcc
gaaaaaggcaattggaatttagtcgctgtccctaaaaccattgataatgatgtcgcccat
accgaattatcggttggttttaactccgccgtcactacaattttagactgtttagatcgg
ttgagttataccgccgccagccatgaccgggtaatggtggtggaggtgatgggacggaca
accggacatctggccctatattcgggaattgtcgggggggccgatgccattttaatccca
gaaattccctattcaattaaaaccctctgtaaacgcattcgcgagttacgcaatctctgg
ggacgaaaattcgccattgtggtagtcgctgaaggggcaaaaaccgccgatggggaaagt
cgatattataaagatgccctgggggaagtccgactgcggggaattggggaatatgtggct
gcggaaattgagaaaaatttgggggtagaagcccgggtgactgtcctgggtcatgttcaa
cggggtggggctccttctgccttggatagattaattggcacagccttcggaaaggtggcg
gtggatttaatcgcccaggaaacctacggggtgatggtggcttggcataataatgctgtc
accactattcccttagatcaggtttttgccgatagtcccctactggttgacccccaggga
ttttgggtggaaacggcccgatccctgggaatttatctcggagaagaacttaatcaagaa
aatattcctacggtaaacccgaatatcaataatttaaaacctttttctttagagacaata
gctcagattaattag

DBGET integrated database retrieval system