KEGG   Planktothrix agardhii: NIES204_05100
Entry
NIES204_05100     CDS       T05658                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00430  Taurine and hypotaurine metabolism
pagh00620  Pyruvate metabolism
pagh00640  Propanoate metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_05100 (ackA)
   00640 Propanoate metabolism
    NIES204_05100 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_05100 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NIES204_05100 (ackA)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     NIES204_05100 (ackA)
SSDB
Motif
Pfam: Acetate_kinase
Other DBs
NCBI-ProteinID: BBD53247
UniProt: A0A2Z6C9V9
LinkDB
Position
complement(602680..603906)
AA seq 408 aa
MKILVLNAGSSSQKSCLYEIKEPALPDYPLHPIWEANIDWTASKELGLMTVKTPGVKQEY
PLDLKSKPEAIAQLFNTLISGETKVLNDFSEITIVGHRVVHGGSDYSEATLIDQKVKSTI
RDLIPLAPSHNPAHLEGIEAVETLLGNVPQVAVFDTAFHRTMPDYATVYPIPYQYFQDGI
KRYGFHGTSHKYCAQKTAKILGKPLEFLKLITCHLGNGCSLAAIKDGISINTTMGFTPLE
GLIMGTRSGSIDPSIVLYLISQYKYDIQQINQILNKESGLKGIVGESGDLRYVLTEMNAG
NAQAKLAFDMYIHHLKMGIGQMLANLGGLDALVFTAGVGEHAEKVREAACQGWEFLGLKL
DLEKNASHPIDQEISTADSRVKILAVHTEEDWAIATECWHIFNSYTQQ
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaaaatattagtattaaatgcgggttcaagttctcaaaaaagttgtctgtatgaaatt
aaagaaccagcattaccagactatcccttacacccgatttgggaagccaatattgattgg
acagcctcaaaagaattaggtttgatgaccgtaaaaactccaggggtaaaacaagaatat
cccttagatttaaagtctaaaccagaggcgatcgcgcaattatttaataccctaatttca
ggggaaaccaaagtattaaatgatttctcagaaattacaatagttggtcatcgagttgtc
catggaggttcagactattcagaagcaacattaattgatcaaaaggtaaaatcaacaatt
agagatttaattcccctcgctcccagtcataaccccgcccatttagaaggaattgaagcc
gtagaaaccctattagggaatgttccccaagtcgcggtttttgatacggcattccatcga
accatgcccgattatgccacggtttatcccattccctatcaatattttcaagatggaatc
aaacgctatggatttcatgggactagccataaatattgcgctcaaaaaacggcgaaaatt
ctaggaaaacctttagaatttttaaaattaattacctgtcatttagggaatggatgttcc
ttagccgctattaaagatgggattagtattaatacaacgatgggatttactcccctagaa
ggattaattatgggaacccgaagcggttctattgatccatccattgtattatatttaatc
agtcaatataaatatgatattcagcaaattaatcaaattttaaataaagaatcggggtta
aaaggtattgtcggggagtcgggcgatctgcgatatgtgttaacagaaatgaacgctgga
aatgctcaagctaaactggcttttgatatgtatattcatcacttaaaaatgggaatcgga
caaatgttagctaatttaggcggtttggatgccttagtttttaccgccggagtcggagaa
cacgccgaaaaagttcgagaagcagcttgtcaaggatgggagtttttaggcttaaaatta
gacttagaaaaaaatgcctctcaccctattgatcaagagatttccaccgcagattcaagg
gttaaaatattagcggttcatacagaggaagattgggcgatcgccactgaatgttggcat
atttttaattcctatacacaacaataa

DBGET integrated database retrieval system