KEGG   Planktothrix agardhii: NIES204_05120
Entry
NIES204_05120     CDS       T05658                                 

Definition
(GenBank) putative D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_05120
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_05120
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     NIES204_05120
    4.1.2.22  fructose-6-phosphate phosphoketolase
     NIES204_05120
SSDB
Motif
Pfam: XFP_N XFP_C XFP
Other DBs
NCBI-ProteinID: BBD53249
UniProt: A0A2Z6C9U3
LinkDB
Position
605015..607423
AA seq 802 aa
MVSAPDRPMETSNPLSEDELRKIDAYWRACNYLAVGMIYLRENPLLKESLKPSDVKHRLL
GHWGSSPGLSFIYIHLNRLIKKYDLDMIYLAGPGHGAPGVLAPVYLEGTYSEIYPNISED
AEGMQKFFKQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHAYGSVFDNPDLISVCVVGD
GEAETGALATAWHSNKFINPIRDGAVLPVLHLNGYKIANPTILSRISHEELEALFKGYGY
KPYFVEGCDPALMHQKMADILETAISEIKAIQAEARSTGIAKRPLWPMIVLRSPKGWTGP
TEVNGHKVEGFWRSHQVPMADVTTNPTHLKLLEDWMRSYKPEELFDANGRLIPELKTLAP
QGTKRMSASPHANGGVLRKDLRLQDFRDYGVPVEYPGKSEVENTNPLGKFLRDVMRNNLQ
NFRVFGPDETASNRLNAIYEVSKKTWMGDFLPEDLDGSELATDGRVMEILSEHTLEGWLE
GYLLTGRHGFFHTYEAFAHVIDSMFNQHAKWLDICRNEVSWRSPISSLNILLSSTVWRQD
HNGFSHQDPGFLDVVTNKSASVTRIYLPPDANCLLSVADHCLKSTNYINVIVADKQKHLQ
FLTMDEAIKHCTKGIGIWEWASSDDCGKDPDIPDVIMAGCGDVATMESLAATAILREEIP
DLKVRFVNVVDLFKLQPDTEHPHGLSDRDFDSLFTTDKPIIFNFHGYPWLIHKLAYRRKN
HANMHVRGYKEKGNINTPLELAINNQVDRFNLVIDVIDRVPKLGSAAAYVRERMKNAIIE
NVNYAHEHGIDKDEIVNWKWPF
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggtatctgcaccagatagacccatggagacgagtaaccctctgagtgaggatgaactg
cgtaagattgatgcctactggcgagcttgtaattatctagccgttggcatgatttattta
cgagaaaatcctttgttaaaagaatccctaaagccctcagatgtcaaacatcggctgtta
ggacattggggttccagtcccgggttgagctttatctacattcacctcaaccgactgatt
aaaaaatacgacctggatatgatttatctagctggcccaggtcatggtgccccaggggta
ttagctccggtttacttagaaggaacctactcagaaatttatcccaatatcagcgaagac
gccgaggggatgcaaaaattctttaaacagttctcgtttcctggtggtattgggagccac
tgtaccccagaaacccccggttccatccatgaaggaggagagctaggctatagtttatct
catgcctatgggtctgtgtttgataacccggacttaatctccgtttgcgtcgttggggat
ggagaagccgaaaccggagctttagcaactgcttggcattctaacaaatttattaacccg
attcgggatggggccgtattgcctgttctgcatttgaatggctacaaaatcgctaacccc
actattttatcgcggattagccatgaagaattggaagccttatttaaaggttatggctat
aaaccctattttgtcgaagggtgtgaccccgcattgatgcaccaaaaaatggcagatatc
ctggaaacagccatttctgaaattaaagccattcaagctgaagcccggtcaacgggaatt
gctaaacgtcccctgtggccgatgattgtattgcggagtcccaaaggctggactggccca
acggaggtcaatggccataaagttgaaggtttttggcggtcgcaccaagtgccaatggct
gatgtcaccaccaaccccacccatctcaagttattagaagattggatgcggagttataag
cccgaagaactgtttgatgccaacggccgtttaattcccgaactgaaaactttggccccc
caaggtacaaaacgaatgagtgccagtccccatgcaaacgggggtgtgctgcgtaaagac
ctacgattgcaggactttcgggactatggtgtgcctgtggaataccccggtaagtccgag
gtggaaaataccaaccccctaggaaaattcctccgggatgtgatgcgaaataatctgcaa
aatttccgcgtatttggccccgatgaaacggcttctaatcgcttaaatgcgatatatgag
gttagtaaaaaaacctggatgggggactttttaccagaggatttagatgggagtgaactg
gcaaccgatggccgggtgatggaaatcctgagtgagcataccttagaaggatggttagaa
ggctatttactcaccggacgtcatggatttttccatacttatgaagcctttgctcacgtg
attgattcgatgtttaatcaacacgcgaaatggttggatatttgccgaaatgaagtgtct
tggcgatcgccaatttcttctttgaatattctcctatcttcaacggtttggcgtcaagat
cataacgggtttagtcatcaagacccgggctttttagatgtggtaacgaataaaagtgcc
agtgttacccgaatttatttaccacccgatgcgaactgtttattatcggttgctgaccat
tgtttaaagagtaccaattatatcaatgtgattgtggcagataaacagaaacatctgcaa
tttttgacaatggatgaagccattaaacattgtacaaaagggattggaatttgggaatgg
gcaagcagtgatgactgtggaaaagatcctgatattcctgatgtaattatggcgggttgt
ggtgatgtggcgacgatggaatctctcgcagctacggcaattttacgcgaagaaattcca
gatctaaaagttagatttgtcaacgtggtggatttatttaagttacaacccgatacggaa
catccccacggtttatccgaccgagattttgatagtttgtttacgacagataaaccaatt
atctttaatttccatggctatccttggttaattcacaagttagcctatcgtcggaaaaat
cacgcgaatatgcacgtcagaggctataaagagaaggggaatattaatactcctttagag
ttggcaattaataaccaagttgaccgttttaacctggttatagatgtaattgaccgagtg
cctaaattgggttcggcggcggcctatgtccgggaacggatgaaaaatgcgatcatcgaa
aatgtcaattatgcccatgaacatggcattgacaaagatgaaattgtgaattggaaatgg
ccgttttaa

KEGG   Planktothrix agardhii: NIES204_05240
Entry
NIES204_05240     CDS       T05658                                 

Definition
(GenBank) putative D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_05240
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_05240
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     NIES204_05240
    4.1.2.22  fructose-6-phosphate phosphoketolase
     NIES204_05240
SSDB
Motif
Pfam: XFP_N XFP Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_29 Methyltransf_8 Methyltransf_2
Other DBs
NCBI-ProteinID: BBD53261
UniProt: A0A2Z6C9U8
LinkDB
Position
complement(636354..638186)
AA seq 610 aa
MVSAPDRPMETSNPLSEDELRKIDAYWRACNYLAVGMIYLRENPLLKESLKPSDVKHRLL
GHWGSSPGLSFIYIHLNRLIKKYDLDMIYLAGPGHGAPGVLGPVYLEGTYSEIYPNISED
AEGMQKFFKQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHAYGSVFDNPDLISVCVVGD
GEAETGALATAWHSNKFLNPIRDGAVLPVLHLNGYKIANPTILSRISHEELEALFKGYGY
KPYFVEGCDPALMHQKMADILETAISEIKAIQAEARSTGIAKRPLWPMIVLRSPKGWTGP
TEVNGHKVEGFWRSHQVPMADVTTNPTHLKLLEDWMRSYKPEELFDANGRLIPELKTLAP
QGTKRMSASPHANGGVLRKNLRLSDFRDYGVPVEYPGKSEVENTNPLGKFLRDVMRNNLQ
NFRVFGPDETASNRLNAIYEVSKKTWMGDFLPEDLDGSELATDGRVMEILSEHTLEGWLE
GYLLTGRHGFFHTYEAFAENMPFADNSFDLVHTSAALHEMNPEQLQQILNEVYRVLKPGG
IFTLVDFHSPTNPIFWPGVAMFLWLFETETAWQLLETDLVQLLSQIGFNVNLPKLYAGGS
LQVIHGVKPE
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggtatctgcaccagatagacccatggagacgagtaaccctctgagtgaggatgaactg
cgtaagattgatgcctactggcgagcttgtaattatctagccgttggcatgatttattta
cgagaaaatcctttgttaaaagaatccctaaagccctcagatgtcaaacatcggctgtta
ggacattggggttccagtcccgggttgagctttatctacattcacctcaaccgactgatt
aaaaaatacgacctggatatgatttatctagctggcccaggtcatggtgccccaggggta
ttaggcccggtttacttagaaggaacctattcagaaatttaccccaatatcagcgaagac
gccgaggggatgcaaaaattctttaaacagttctcgtttcctggtggtattgggagccac
tgtactcctgaaacccccggttccatccatgaaggaggagagctaggctatagtttatct
catgcctatgggtctgtgtttgataacccggacttaatctccgtttgcgtcgttggggat
ggagaagccgaaaccggagctttagcaactgcttggcattctaacaaatttctgaacccg
attcgggatggggccgtattgcctgttctgcatttgaatggctacaaaatcgctaacccc
actattttatcgcggattagccatgaagaattggaagccttatttaaaggttatggctat
aaaccctattttgtcgaagggtgtgaccccgcattgatgcaccaaaaaatggcagatatc
ctggaaacagccatttctgaaattaaagccattcaagctgaagcccggtcaacgggaatt
gctaaacgtcccctgtggccgatgattgtattgcggagtcccaaaggctggactggccca
acggaggtcaatggccataaagttgaaggtttttggcggtcgcaccaagtgccgatggct
gatgtcaccaccaaccccacccatctcaagttattagaagattggatgcggagttataag
cccgaagaactgtttgatgccaacggccgtttaattcccgaactgaaaactttggccccc
caaggtacaaaacgaatgagtgccagtccccatgcaaacgggggtgtgctgcgtaaaaac
ctacgattgtcggactttcgggactatggtgtgcctgtggaataccccggtaagtccgag
gtggaaaataccaaccccctaggaaaattcctccgggatgtgatgcgaaataatctgcaa
aatttccgcgtatttggccccgatgaaacggcttctaatcgcttaaatgcgatatatgag
gttagtaaaaaaacctggatgggggactttttaccagaggatttagatgggagtgaactg
gcaaccgatggccgggtgatggaaatcctgagtgagcataccttagaaggatggttagaa
ggctatttactcaccggacgtcatggatttttccatacttatgaagcctttgcggaaaat
atgccctttgccgataacagctttgacctggtgcacaccagcgccgccctgcacgaaatg
aaccccgaacagttgcagcaaattcttaatgaggtttaccgcgttctgaaaccgggaggg
atttttaccctggttgatttccattccccgactaatccgatattttggccgggggtagcc
atgtttctctggttatttgaaacggaaacagcttggcaattgttagaaacagatttggtt
caattattatcacaaattggctttaatgtcaatctccctaaactttatgctggaggaagt
ttacaagtaattcatggggttaaacctgaatag

DBGET integrated database retrieval system