KEGG   Planktothrix agardhii: NIES204_05390
Entry
NIES204_05390     CDS       T05658                                 

Gene name
cysE
Definition
(GenBank) serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00270  Cysteine and methionine metabolism
pagh00920  Sulfur metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NIES204_05390 (cysE)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NIES204_05390 (cysE)
Enzymes [BR:pagh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     NIES204_05390 (cysE)
SSDB
Motif
Pfam: Hexapep Hexapep_2 ZapB SATase_N DUF2937 Prefoldin_3 TRI9 Kringle
Other DBs
NCBI-ProteinID: BBD53276
UniProt: A0A2Z6C9Y1
LinkDB
Position
complement(653865..654680)
AA seq 271 aa
MLKTLQHDFSIIFERDPAARNWLEVIFCYPGLQALLCHRLAHGLYGFGLPFIPRLISHLA
RFLTGIEIHPGAVIGKGVFIDHGMGVVIGETAILGDFCLIYQGVTLGGTGKESGKRHPTL
GENVVVGAGAKVLGNIQLGENVRIGAGSVVLRDVPANCTVVGIPGRIVYRSGVRIDPLEH
GSLPDSEAQVIRMLVDRIELLEQQVQSLQQQSSVAQNQLEAALKLEYCPNPDRLSVQEQT
THYGQEYSVSTATHCRIKDRTIQQFLDGAGI
NT seq 816 nt   +upstreamnt  +downstreamnt
atgctcaagacccttcaacatgacttcagcattatctttgaacgtgatcctgctgctcgc
aactggttagaagttatcttctgctatcccggtcttcaggctttattatgccaccgccta
gcacacgggttatatggttttgggcttccctttatcccccgtctaatttcccatctggct
cggtttctgacgggaatcgaaattcatcctggggctgtgattggtaagggcgtattcatc
gatcatggtatgggagttgtgattggtgagacggctattttaggggatttttgcctgatt
tatcaaggcgtcaccctgggaggcacagggaaagaaagcggtaaacgccatcctactctg
ggggaaaatgtggtggtcggcgccggagctaaagttttaggtaatattcaattgggggag
aatgttcggattggggccggatcggtggttctgcgggatgttccagctaattgtaccgtg
gtcgggattccgggtaggattgtctatcgctctggggtgcggattgatcccctcgaacat
ggcagtcttcctgactcggaggcgcaggtgattaggatgttagtggatcggattgaacta
ttggaacaacaagtacagtccctacaacagcaatcttctgtggctcaaaatcaactcgaa
gcggctctgaaattagaatactgtcccaaccccgataggttatcggttcaggaacaaacc
acccattatggtcaggaatactcggtttcgacggctacccattgtcggataaaagataga
actattcaacaatttttagatggtgctgggatttaa

DBGET integrated database retrieval system