KEGG   Planktothrix agardhii: NIES204_05520Help
Entry
NIES204_05520     CDS       T05658                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01130  Biosynthesis of antibiotics
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_05520
   00020 Citrate cycle (TCA cycle)
    NIES204_05520
   00620 Pyruvate metabolism
    NIES204_05520
Enzymes [BR:pagh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES204_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BBD53289
UniProt: A0A2Z6C9X7
LinkDB All DBs
Position
complement(671635..672897)
Genome map
AA seq 420 aa AA seqDB search
MAIHEVFMPALSSTMTEGKIVSWQKSPGDKIEKGETVLIVESDKADMDVESFYEGYLATI
ITPAGEAAPVGNTIALIAETQGEIEQAKQKAASATPATPAAVAQPVAASPVAATAVVATP
TPPKNRRIIASPRARKLAKELNLDLATLTGSGPNGRIIAEDVETASGRPAAVQTPSQIPA
PAVSKPMTAPTPATVPLGQVAPMNTLQNAVVRNMTASLSVPVFRVGYTITTDGLDQLYKQ
LKSKGVTMTALLAKAVAMTLQKHPILNASYVENGIQYRAGINIAIAVAMPDGGLITPVLK
NADQIDLYSLSRTWKDLVERSRAKQLQPDEYSSGTFTLSNLGMFGVDKFDAILPPGQGSI
LAIGASRPQLVVSADGSMAVKRQMQVNITCDHRIIYGADAATFLQSLAKLIETNVQSLTM
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccattcatgaagtttttatgcccgccctgagttccaccatgaccgagggtaaaatc
gtttcttggcaaaaatcccccggtgataaaattgaaaagggcgaaacggtcttgatcgtt
gagtcggataaggcggatatggatgtggaatccttctatgaagggtatctggccacgatt
attactccggccggagaagctgcccccgtgggtaataccattgccttaatcgcggaaact
caaggggaaattgaacaggcgaaacaaaaagccgcctctgctaccccggctacccccgcc
gccgtagcccaacccgttgcagctagtcccgtagcagccacggccgttgtcgcaaccccg
accccccctaaaaatcgccgaattattgcttctcctcgcgcccgcaaattggccaaggaa
ctcaatttagatttagcaaccttaaccggaagtgggccaaatggtcggatcattgcggaa
gacgtggaaacagcatcgggacgtccggctgcggttcagactccctcccaaatcccggct
ccggctgttagtaagcccatgacagccccaactccagcaactgttcccctgggtcaagtt
gccccgatgaataccctccaaaacgccgtggtcagaaatatgaccgcgagtttatcggtg
ccggtattccgggtgggatatacgattacaacggatgggttggatcagctttataaacaa
ctgaaatctaagggtgtcaccatgacggcactcttagcaaaagcggtggcgatgacgtta
caaaaacatccgattttgaatgccagttatgtagaaaatgggattcaatatcgggcggga
attaatattgcgatcgccgtggctatgcccgatggtggtttaattactccggtattaaaa
aatgccgatcaaattgatctttattccctgtctcggacttggaaagatttagttgaaagg
tctagggcgaaacagttacaacccgatgaatatagcagtggaacctttactctctccaat
ttaggaatgtttggagtcgataagtttgatgcgattttacctccgggtcaaggttcaatt
ttagccatcggtgcgtcccgtccccaattagtggtttctgccgatggttctatggcggtt
aaacgccaaatgcaagtgaatattacttgtgatcaccggattatttatggggcggatgcg
gcgacattcctacaaagtttggctaaattgattgaaactaatgttcagtcgttgactatg
taa

DBGET integrated database retrieval system