KEGG   Planktothrix agardhii: NIES204_05520
Entry
NIES204_05520     CDS       T05658                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_05520
   00020 Citrate cycle (TCA cycle)
    NIES204_05520
   00620 Pyruvate metabolism
    NIES204_05520
Enzymes [BR:pagh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIES204_05520
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: BBD53289
UniProt: A0A2Z6C9X7
LinkDB
Position
complement(671635..672897)
AA seq 420 aa
MAIHEVFMPALSSTMTEGKIVSWQKSPGDKIEKGETVLIVESDKADMDVESFYEGYLATI
ITPAGEAAPVGNTIALIAETQGEIEQAKQKAASATPATPAAVAQPVAASPVAATAVVATP
TPPKNRRIIASPRARKLAKELNLDLATLTGSGPNGRIIAEDVETASGRPAAVQTPSQIPA
PAVSKPMTAPTPATVPLGQVAPMNTLQNAVVRNMTASLSVPVFRVGYTITTDGLDQLYKQ
LKSKGVTMTALLAKAVAMTLQKHPILNASYVENGIQYRAGINIAIAVAMPDGGLITPVLK
NADQIDLYSLSRTWKDLVERSRAKQLQPDEYSSGTFTLSNLGMFGVDKFDAILPPGQGSI
LAIGASRPQLVVSADGSMAVKRQMQVNITCDHRIIYGADAATFLQSLAKLIETNVQSLTM
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggccattcatgaagtttttatgcccgccctgagttccaccatgaccgagggtaaaatc
gtttcttggcaaaaatcccccggtgataaaattgaaaagggcgaaacggtcttgatcgtt
gagtcggataaggcggatatggatgtggaatccttctatgaagggtatctggccacgatt
attactccggccggagaagctgcccccgtgggtaataccattgccttaatcgcggaaact
caaggggaaattgaacaggcgaaacaaaaagccgcctctgctaccccggctacccccgcc
gccgtagcccaacccgttgcagctagtcccgtagcagccacggccgttgtcgcaaccccg
accccccctaaaaatcgccgaattattgcttctcctcgcgcccgcaaattggccaaggaa
ctcaatttagatttagcaaccttaaccggaagtgggccaaatggtcggatcattgcggaa
gacgtggaaacagcatcgggacgtccggctgcggttcagactccctcccaaatcccggct
ccggctgttagtaagcccatgacagccccaactccagcaactgttcccctgggtcaagtt
gccccgatgaataccctccaaaacgccgtggtcagaaatatgaccgcgagtttatcggtg
ccggtattccgggtgggatatacgattacaacggatgggttggatcagctttataaacaa
ctgaaatctaagggtgtcaccatgacggcactcttagcaaaagcggtggcgatgacgtta
caaaaacatccgattttgaatgccagttatgtagaaaatgggattcaatatcgggcggga
attaatattgcgatcgccgtggctatgcccgatggtggtttaattactccggtattaaaa
aatgccgatcaaattgatctttattccctgtctcggacttggaaagatttagttgaaagg
tctagggcgaaacagttacaacccgatgaatatagcagtggaacctttactctctccaat
ttaggaatgtttggagtcgataagtttgatgcgattttacctccgggtcaaggttcaatt
ttagccatcggtgcgtcccgtccccaattagtggtttctgccgatggttctatggcggtt
aaacgccaaatgcaagtgaatattacttgtgatcaccggattatttatggggcggatgcg
gcgacattcctacaaagtttggctaaattgattgaaactaatgttcagtcgttgactatg
taa

DBGET integrated database retrieval system